ID   AL592062   standard; DNA; VRT; 106778 BP.
XX
AC   AL592062;
XX
SV   AL592062.11
XX
DT   13-JUN-2001 (Rel. 68, Created)
DT   03-OCT-2002 (Rel. 73, Last updated, Version 14)
XX
DE   Zebrafish DNA sequence from clone XX-6CSE Contains part of a novel gene
DE   similar to PCDH15 (procadherin 15), two transposase pseudogenes, a putative
DE   novel gene and two CpG islands.
XX
KW   CpG island; HTG; PCDH15; procadherin; transposase.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-106778
RA   Lloyd D.;
RT   ;
RL   Submitted (07-AUG-2002) to the EMBL/GenBank/DDBJ databases.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: zface@sanger.ac.uk Clone requests:
RL   clonerequest@sanger.ac.uk
XX
CC   During sequence assembly data is compared from overlapping clones.
CC   Where differences are found these are annotated as variations
CC   together with a note of the overlapping clone name. Note that the
CC   variation annotation may not be found in the sequence submission
CC   corresponding to the overlapping clone, as we submit sequences with
CC   only a small overlap as described above.
XX
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one plasmid subclone or more than one
CC   M13 subclone; and the assembly was confirmed by restriction digest.
XX
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
XX
CC   XX-6CSE is from the Unknown library - may be Incyte-BAC?
CC   VECTOR: pBeloBAC11
XX
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: zface@sanger.ac.uk
CC   --------------
XX
CC   Repeat names beginning "Dr" were identified by the Recon repeat discovery
CC   system (Zhirong Bao and Sean Eddy, submitted), and those beginning "drr"
CC   were identified by Rick Waterman (Stephen Johnson lab, WashU).  For
CC   further information see http://www/Projects/D_rerio/fishmask.shtml
XX
CC   This sequence is the entire insert of clone XX-6CSE
CC   The true right end of clone XX-PAC13CSE is at 50674 in this sequence.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..106778
FT                   /db_xref="taxon:7955"
FT                   /organism="Danio rerio"
FT                   /clone="XX-6CSE"
FT                   /clone_lib="Zeb_BAC"
FT   CDS             join(<14501..14661,22113..22268,35274..35393,37083..37193,
FT                   41896..42066,51079..51187,60850..60962,66079..66285,
FT                   68245..68379,88143..88292,94219..94442,94496..94628,
FT                   98831..>98910)
FT                   /codon_start=3
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="identical to BAC7CSE.1 due to clone overlap"
FT                   /note="match: proteins: Sw:Q96QU1 Sw:Q99PJ1"
FT                   /gene="BAC7CSE.1"
FT                   /product="SI:BAC6CSE.1 (novel protein similar to
FT                   procadherin 15 (PCDH15))"
FT                   /protein_id="CAD52120.1"
FT                   /translation="TILVENMQINGRARDPDRTISLTLLDNYDYWVILDPALQRLFLNS
FT                   TGRVLDRDPPSSITTIVVQIQCTNELVGTVILHEVRIVVRDRNDNTPRFQQPRYYVSVN
FT                   ELTPVGTTIFTGFSGNNGATDIDDGPNGQIEYAIQYNPNDPMSNRTVRIAGTLSGNIVL
FT                   AERLNYEERTRYLIIVQANDRAPYPGTRRTATTTLTLDVLDGDDLGPMFLPCVLVNNTQ
FT                   DCNPVTYRVAIPELTDPSKLNPLNVTPPIRAIDQDRNIQPPSDRPGILYFILVGTPSTY
FT                   PEFFTLNRSTAELRLLKSVDRELYQRFSLVIKAEQDNGHPLPAYSKLEIEILDENNQAP
FT                   YFQQSSYRGFVSESSSVGTTISASANLTAPLAIIALDNDIEETKDPQLKITLNEYTSIF
FT                   TITTSGITRFLTLLKPVDREIQTNYTLTLVATDGVQQSRPVTVDILVIDANDNTPTFAQ
FT                   VSYSVEIFTNMLPGETVLQLTAQDADAGLNGLITYAILAGDHGDFIINNRTGRITLAPG
FT                   VMLTVGRSYALTVRAADNAPDTERRSDTNTLHHILSSITTVYIEVLPPNNQSPPRFPLQ
FT                   TYNLEISEAMRIGAILLNLQATDRELDPITYRIETGDPQEVFNLSRT"
FT   misc_feature    19579..20176
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="CpG island"
FT   CDS             complement(35781..36592)
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="SI:BAC6CSE.4 (novel transposase pseudogene)"
FT                   /note="match: proteins: Tr:Q9XYD5 Tr:Q9PW00 Tr:Q9W709
FT                   Tr:Q24397"
FT                   /pseudo
FT                   /gene="SI:BAC6CSE.4"
FT   misc_feature    69673..70338
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="CpG island"
FT   polyA_site      complement(79792)
FT   polyA_signal    complement(79807..79812)
FT   mRNA            join(complement(83248..83515),complement(82509..82697),
FT                   complement(82084..82241),complement(81476..81571),
FT                   complement(79792..80739))
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="identical to BAC7CSE.2 due to clone overlap"
FT                   /note="match: ESTs: Em:AL715192 Em:AL722461 Em:AI416375
FT                   Em:BF717612 Em:AI545857 Em:AL715161 Em:BQ449658 Em:AW018967
FT                   Em:AA495264"
FT                   /gene="BAC7CSE.2"
FT                   /product="SI:BAC6CSE.3 (putative novel transcript)"
FT   CDS             complement(105865..106567)
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="SI:BAC6CSE.2 (novel transposase pseudogene)"
FT                   /note="identical to BAC7CSE.3 due to clone overlap"
FT                   /note="match: proteins: Tr:Q16925 Tr:Q9XYD5 Tr:Q24258
FT                   Tr:Q98TI8 Tr:Q16922"
FT                   /pseudo
FT                   /gene="BAC7CSE.3"
FT   misc_feature    2757..2820
FT                   /note="Tandem repeat. Inconsistency in the number of copies
FT                   of the repeat element between subclones."
FT   misc_feature    7810..7875
FT                   /note="Tandem repeat. Inconsistency in the number of copies
FT                   of the repeat element between subclones."
FT   misc_feature    13670..13723
FT                   /note="Tandem repeat. Inconsistency in the number of copies
FT                   of the repeat element between subclones."
FT   misc_feature    28436..28531
FT                   /note="Tandem repeat. Inconsistency in the number of copies
FT                   of the repeat element between subclones."
FT   misc_feature    59954..60016
FT                   /note="Single clone region. Sequence from reads from a
FT                   short insert library derived from a single pUC clone.
FT                   Restriction digest data confirm the assembly."
FT   misc_feature    82286..82367
FT                   /note="Tandem repeat. Inconsistency in the number of copies
FT                   of the repeat element between subclones."
FT   repeat_region   268..284
FT                   /note="2.1 copies 8 mer GTTTCTCT 25% conserved"
FT   repeat_region   439..449
FT                   /note="2.2 copies 5 mer TGAAT 22% conserved"
FT   repeat_region   448..463
FT                   /note="2.7 copies 6 mer TTTTTG 32% conserved"
FT   repeat_region   944..953
FT                   /note="2.5 copies 4 mer TAAG 20% conserved"
FT   repeat_region   1014..1029
FT                   /note="2.3 copies 7 mer CATTATA 32% conserved"
FT   repeat_region   1056..1079
FT                   /note="12.0 copies 2 mer CA 39% conserved"
FT   repeat_region   1710..1732
FT                   /note="3.8 copies 6 mer CCTTTA 28% conserved"
FT   repeat_region   2006..2052
FT                   /note="23.5 copies 2 mer AT 94% conserved"
FT   repeat_region   2639..2648
FT                   /note="2.0 copies 5 mer TATTA 20% conserved"
FT   repeat_region   2678..2688
FT                   /note="3.7 copies 3 mer TAT 22% conserved"
FT   repeat_region   2692..2822
FT                   /note="65.5 copies 2 mer TA 140% conserved"
FT   repeat_region   2823..2837
FT                   /note="5.0 copies 3 mer ATT 30% conserved"
FT   repeat_region   2887..2958
FT                   /note="7.2 copies 10 mer TATAATATTA 63% conserved"
FT   repeat_region   2895..3064
FT                   /note="85.0 copies 2 mer TA 208% conserved"
FT   repeat_region   3074..3097
FT                   /note="6.0 copies 4 mer ATTA 39% conserved"
FT   repeat_region   3094..3118
FT                   /note="8.3 copies 3 mer ATT 36% conserved"
FT   repeat_region   3098..3124
FT                   /note="5.4 copies 5 mer TTATT 38% conserved"
FT   repeat_region   3107..3125
FT                   /note="19.0 copies 1 mer T 20% conserved"
FT   repeat_region   3164..3184
FT                   /note="2.1 copies 10 mer TAGCCCTATA 42% conserved"
FT   repeat_region   3652..3661
FT                   /note="5.0 copies 2 mer TG 20% conserved"
FT   repeat_region   3856..3868
FT                   /note="2.6 copies 5 mer ATTTT 26% conserved"
FT   repeat_region   3859..3872
FT                   /note="4.7 copies 3 mer TTA 21% conserved"
FT   repeat_region   3910..3925
FT                   /note="3.2 copies 5 mer TTTAT 32% conserved"
FT   repeat_region   3935..3948
FT                   /note="2.3 copies 6 mer TTTAGT 28% conserved"
FT   repeat_region   4096..4112
FT                   /note="3.4 copies 5 mer CAAAG 25% conserved"
FT   repeat_region   4204..4217
FT                   /note="2.3 copies 6 mer CACATA 28% conserved"
FT   repeat_region   4899..4908
FT                   /note="2.5 copies 4 mer TTAA 20% conserved"
FT   repeat_region   5130..5147
FT                   /note="6.0 copies 3 mer TTA 29% conserved"
FT   repeat_region   5516..5529
FT                   /note="2.0 copies 7 mer TGCCTTC 28% conserved"
FT   repeat_region   6455..6526
FT                   /note="18.0 copies 4 mer ATTT 58% conserved"
FT   repeat_region   6472..6518
FT                   /note="47.0 copies 1 mer T 49% conserved"
FT   repeat_region   7424..7433
FT                   /note="2.5 copies 4 mer GTCT 20% conserved"
FT   repeat_region   7724..7742
FT                   /note="4.8 copies 4 mer TTAT 29% conserved"
FT   repeat_region   7727..7742
FT                   /note="3.2 copies 5 mer TTTAT 25% conserved"
FT   repeat_region   7810..7875
FT                   /note="33.0 copies 2 mer AT 132% conserved"
FT   repeat_region   8308..8466
FT                   /note="79.5 copies 2 mer TG 273% conserved"
FT   repeat_region   8466..8490
FT                   /note="12.5 copies 2 mer TA 29% conserved"
FT   repeat_region   8475..8518
FT                   /note="14.7 copies 3 mer TAT 31% conserved"
FT   repeat_region   8493..8503
FT                   /note="2.2 copies 5 mer TTTTA 22% conserved"
FT   repeat_region   8565..8582
FT                   /note="2.0 copies 9 mer TTTATACAT 29% conserved"
FT   repeat_region   8602..8620
FT                   /note="1.9 copies 10 mer CATTAAGTGA 38% conserved"
FT   repeat_region   8621..8636
FT                   /note="4.0 copies 4 mer TATT 25% conserved"
FT   repeat_region   8634..8645
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   8644..8669
FT                   /note="3.2 copies 8 mer TTGTAAAA 25% conserved"
FT   repeat_region   9813..9828
FT                   /note="8.0 copies 2 mer AT 23% conserved"
FT   repeat_region   9996..10017
FT                   /note="3.1 copies 7 mer TTTTTTC 26% conserved"
FT   repeat_region   9998..10008
FT                   /note="2.2 copies 5 mer TTTTC 22% conserved"
FT   repeat_region   10003..10034
FT                   /note="3.6 copies 9 mer TTTTCTCTA 37% conserved"
FT   repeat_region   10707..10716
FT                   /note="2.5 copies 4 mer TAAA 20% conserved"
FT   repeat_region   10789..10811
FT                   /note="5.8 copies 4 mer TTTA 32% conserved"
FT   repeat_region   10793..10811
FT                   /note="2.7 copies 7 mer TTTATTT 38% conserved"
FT   repeat_region   10821..10830
FT                   /note="2.5 copies 4 mer AATA 20% conserved"
FT   repeat_region   11259..11269
FT                   /note="2.8 copies 4 mer GTTT 22% conserved"
FT   repeat_region   11298..11309
FT                   /note="2.0 copies 6 mer TTGCAT 24% conserved"
FT   repeat_region   11544..11566
FT                   /note="4.6 copies 5 mer TACAA 37% conserved"
FT   repeat_region   11596..11609
FT                   /note="4.7 copies 3 mer TTA 28% conserved"
FT   repeat_region   11673..11694
FT                   /note="5.5 copies 4 mer TTTA 44% conserved"
FT   repeat_region   12299..12311
FT                   /note="2.2 copies 6 mer AGCATG 26% conserved"
FT   repeat_region   13063..13073
FT                   /note="2.2 copies 5 mer CTGTT 22% conserved"
FT   repeat_region   13180..13192
FT                   /note="2.6 copies 5 mer GAGGA 26% conserved"
FT   repeat_region   13437..13452
FT                   /note="16.0 copies 1 mer T 32% conserved"
FT   repeat_region   13540..13564
FT                   /note="2.1 copies 12 mer TTGCGATTAGAT 43% conserved"
FT   repeat_region   13636..13645
FT                   /note="2.5 copies 4 mer ATAC 20% conserved"
FT   repeat_region   13654..13670
FT                   /note="8.5 copies 2 mer TG 34% conserved"
FT   repeat_region   13670..13724
FT                   /note="27.5 copies 2 mer TA 110% conserved"
FT   repeat_region   13724..13752
FT                   /note="14.5 copies 2 mer TG 58% conserved"
FT   repeat_region   13756..13820
FT                   /note="32.5 copies 2 mer TA 67% conserved"
FT   repeat_region   13824..13838
FT                   /note="7.5 copies 2 mer TG 30% conserved"
FT   repeat_region   14385..14395
FT                   /note="2.8 copies 4 mer ATTG 22% conserved"
FT   repeat_region   14607..14617
FT                   /note="2.2 copies 5 mer CCCTG 22% conserved"
FT   repeat_region   14677..14686
FT                   /note="2.5 copies 4 mer CATT 20% conserved"
FT   repeat_region   15329..15340
FT                   /note="2.0 copies 6 mer AGTTAA 24% conserved"
FT   repeat_region   15450..15459
FT                   /note="3.3 copies 3 mer CAG 20% conserved"
FT   repeat_region   15868..15877
FT                   /note="2.5 copies 4 mer TGTT 20% conserved"
FT   repeat_region   16508..16520
FT                   /note="13.0 copies 1 mer T 26% conserved"
FT   repeat_region   16522..16531
FT                   /note="3.3 copies 3 mer TTG 20% conserved"
FT   repeat_region   17192..17208
FT                   /note="4.2 copies 4 mer GAGC 25% conserved"
FT   repeat_region   17208..17221
FT                   /note="2.0 copies 7 mer GCGTGTG 28% conserved"
FT   repeat_region   17311..17321
FT                   /note="2.2 copies 5 mer ATTGA 22% conserved"
FT   repeat_region   17389..17405
FT                   /note="17.0 copies 1 mer T 34% conserved"
FT   repeat_region   17509..17520
FT                   /note="2.0 copies 6 mer TTAACT 24% conserved"
FT   repeat_region   17586..17618
FT                   /note="16.5 copies 2 mer TA 66% conserved"
FT   repeat_region   17650..17664
FT                   /note="7.5 copies 2 mer TA 23% conserved"
FT   repeat_region   17893..17913
FT                   /note="1.9 copies 11 mer TTTGACCGTTT 35% conserved"
FT   repeat_region   17970..17979
FT                   /note="2.5 copies 4 mer GCGT 20% conserved"
FT   repeat_region   18008..18078
FT                   /note="35.5 copies 2 mer TA 142% conserved"
FT   repeat_region   18123..18134
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   18551..18565
FT                   /note="15.0 copies 1 mer A 30% conserved"
FT   repeat_region   18839..18851
FT                   /note="2.2 copies 6 mer TGCAGT 26% conserved"
FT   repeat_region   18883..18893
FT                   /note="2.8 copies 4 mer TTAA 22% conserved"
FT   repeat_region   19072..19083
FT                   /note="3.0 copies 4 mer CTGT 24% conserved"
FT   repeat_region   19210..19226
FT                   /note="5.7 copies 3 mer TCC 25% conserved"
FT   repeat_region   21264..21273
FT                   /note="2.5 copies 4 mer AAGG 20% conserved"
FT   repeat_region   21343..21358
FT                   /note="4.0 copies 4 mer TTAT 23% conserved"
FT   repeat_region   21368..21409
FT                   /note="21.0 copies 2 mer GT 84% conserved"
FT   repeat_region   21407..21419
FT                   /note="3.2 copies 4 mer TGTA 26% conserved"
FT   repeat_region   21417..21482
FT                   /note="33.0 copies 2 mer TA 132% conserved"
FT   repeat_region   21480..21550
FT                   /note="17.8 copies 4 mer ATAG 142% conserved"
FT   repeat_region   22299..22319
FT                   /note="10.5 copies 2 mer TC 24% conserved"
FT   repeat_region   22470..22490
FT                   /note="7.0 copies 3 mer ATT 42% conserved"
FT   repeat_region   22539..22562
FT                   /note="2.0 copies 12 mer AGAACTGCATCC 48% conserved"
FT   repeat_region   22572..22666
FT                   /note="47.5 copies 2 mer TA 190% conserved"
FT   repeat_region   22818..22830
FT                   /note="2.6 copies 5 mer ATACA 26% conserved"
FT   repeat_region   22887..22898
FT                   /note="2.0 copies 6 mer AAGTTA 24% conserved"
FT   repeat_region   23349..23359
FT                   /note="2.2 copies 5 mer CGTCA 22% conserved"
FT   repeat_region   23878..23887
FT                   /note="2.5 copies 4 mer CAAG 20% conserved"
FT   repeat_region   24374..24394
FT                   /note="5.2 copies 4 mer AAAC 33% conserved"
FT   repeat_region   24420..24435
FT                   /note="16.0 copies 1 mer A 32% conserved"
FT   repeat_region   25713..25727
FT                   /note="3.8 copies 4 mer TTTA 23% conserved"
FT   repeat_region   25893..25914
FT                   /note="22.0 copies 1 mer A 44% conserved"
FT   repeat_region   25942..25952
FT                   /note="11.0 copies 1 mer T 22% conserved"
FT   repeat_region   26933..26946
FT                   /note="14.0 copies 1 mer A 28% conserved"
FT   repeat_region   26957..26975
FT                   /note="19.0 copies 1 mer A 38% conserved"
FT   repeat_region   27114..27133
FT                   /note="3.3 copies 6 mer TAAATG 40% conserved"
FT   repeat_region   27278..27287
FT                   /note="10.0 copies 1 mer A 20% conserved"
FT   repeat_region   27345..27355
FT                   /note="3.7 copies 3 mer TTA 22% conserved"
FT   repeat_region   27477..27502
FT                   /note="2.2 copies 12 mer GCTTAAAATTAT 43% conserved"
FT   repeat_region   27667..27678
FT                   /note="2.4 copies 5 mer CTCTC 24% conserved"
FT   repeat_region   27775..27785
FT                   /note="11.0 copies 1 mer T 22% conserved"
FT   repeat_region   28332..28342
FT                   /note="2.2 copies 5 mer AATTA 22% conserved"
FT   repeat_region   28381..28395
FT                   /note="15.0 copies 1 mer A 30% conserved"
FT   repeat_region   28402..28436
FT                   /note="17.5 copies 2 mer TC 52% conserved"
FT   repeat_region   28436..28545
FT                   /note="55.0 copies 2 mer TA 193% conserved"
FT   repeat_region   28552..28563
FT                   /note="2.0 copies 6 mer GTGATT 24% conserved"
FT   repeat_region   28797..28852
FT                   /note="28.0 copies 2 mer AT 60% conserved"
FT   repeat_region   29961..29972
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   30120..30141
FT                   /note="11.0 copies 2 mer GA 26% conserved"
FT   repeat_region   30407..30423
FT                   /note="2.4 copies 7 mer TTTTGTA 27% conserved"
FT   repeat_region   30440..30449
FT                   /note="2.5 copies 4 mer TGTT 20% conserved"
FT   repeat_region   31316..31326
FT                   /note="2.2 copies 5 mer AAAAG 22% conserved"
FT   repeat_region   31372..31383
FT                   /note="2.4 copies 5 mer TATAA 24% conserved"
FT   repeat_region   31793..31804
FT                   /note="12.0 copies 1 mer A 24% conserved"
FT   repeat_region   32250..32260
FT                   /note="11.0 copies 1 mer A 22% conserved"
FT   repeat_region   32493..32502
FT                   /note="5.0 copies 2 mer CA 20% conserved"
FT   repeat_region   32552..32561
FT                   /note="2.5 copies 4 mer ACGC 20% conserved"
FT   repeat_region   32624..32634
FT                   /note="2.2 copies 5 mer TTGTT 22% conserved"
FT   repeat_region   32628..32637
FT                   /note="2.5 copies 4 mer TTTG 20% conserved"
FT   repeat_region   34213..34227
FT                   /note="2.5 copies 6 mer TAGTGC 30% conserved"
FT   repeat_region   34669..34681
FT                   /note="2.2 copies 6 mer ATTTAA 26% conserved"
FT   repeat_region   34722..34737
FT                   /note="2.0 copies 8 mer AATTTATT 32% conserved"
FT   repeat_region   34723..34738
FT                   /note="4.0 copies 4 mer ATTT 23% conserved"
FT   repeat_region   34873..34882
FT                   /note="10.0 copies 1 mer A 20% conserved"
FT   repeat_region   34886..34898
FT                   /note="2.2 copies 6 mer CAAATG 26% conserved"
FT   repeat_region   35099..35154
FT                   /note="28.0 copies 2 mer AC 67% conserved"
FT   repeat_region   35691..35700
FT                   /note="2.0 copies 5 mer CCTTG 20% conserved"
FT   repeat_region   36223..36233
FT                   /note="3.7 copies 3 mer CAC 22% conserved"
FT   repeat_region   37246..37257
FT                   /note="2.0 copies 6 mer TGTTCT 24% conserved"
FT   repeat_region   37426..38141
FT                   /note="179.0 copies 4 mer TTTA 231% conserved"
FT   repeat_region   37529..37539
FT                   /note="3.7 copies 3 mer TTA 22% conserved"
FT   repeat_region   37574..37588
FT                   /note="2.1 copies 7 mer TTATGCA 30% conserved"
FT   repeat_region   37736..37752
FT                   /note="2.4 copies 7 mer ATTTTTG 27% conserved"
FT   repeat_region   37804..37813
FT                   /note="3.3 copies 3 mer TAT 20% conserved"
FT   repeat_region   37886..37952
FT                   /note="13.4 copies 5 mer ATATT 134% conserved"
FT   repeat_region   37977..37992
FT                   /note="2.7 copies 6 mer TTATGA 23% conserved"
FT   repeat_region   38301..38331
FT                   /note="2.1 copies 15 mer TGAGTGTGAATTATG 44% conserved"
FT   repeat_region   38314..38326
FT                   /note="2.2 copies 6 mer TGTGAG 26% conserved"
FT   repeat_region   38407..38417
FT                   /note="2.2 copies 5 mer TGAGT 22% conserved"
FT   repeat_region   38504..38526
FT                   /note="5.8 copies 4 mer ATTT 39% conserved"
FT   repeat_region   38535..38546
FT                   /note="12.0 copies 1 mer G 24% conserved"
FT   repeat_region   38653..38662
FT                   /note="2.5 copies 4 mer ATTT 20% conserved"
FT   repeat_region   38744..38761
FT                   /note="3.0 copies 6 mer ATTTTT 27% conserved"
FT   repeat_region   39173..39221
FT                   /note="12.2 copies 4 mer TAAA 98% conserved"
FT   repeat_region   39823..39833
FT                   /note="2.2 copies 5 mer AAATC 22% conserved"
FT   repeat_region   40247..40312
FT                   /note="1.9 copies 34 mer GCGTAAAATTACAGAAATTTACCATAAAATAACC
FT                   96% conserved"
FT   repeat_region   40425..40441
FT                   /note="17.0 copies 1 mer T 34% conserved"
FT   repeat_region   40714..40732
FT                   /note="4.8 copies 4 mer TTTA 38% conserved"
FT   repeat_region   41121..41133
FT                   /note="2.2 copies 6 mer TACATT 26% conserved"
FT   repeat_region   41292..41338
FT                   /note="9.4 copies 5 mer AAAAT 35% conserved"
FT   repeat_region   41302..41324
FT                   /note="23.0 copies 1 mer A 28% conserved"
FT   repeat_region   41328..41338
FT                   /note="2.8 copies 4 mer AAAT 22% conserved"
FT   repeat_region   41340..41407
FT                   /note="22.7 copies 3 mer TTA 127% conserved"
FT   repeat_region   41427..41438
FT                   /note="2.4 copies 5 mer AAAGA 24% conserved"
FT   repeat_region   41700..41735
FT                   /note="7.2 copies 5 mer TATTT 38% conserved"
FT   repeat_region   41739..41759
FT                   /note="4.2 copies 5 mer ATATG 33% conserved"
FT   repeat_region   41817..41831
FT                   /note="2.1 copies 7 mer TTCTATC 30% conserved"
FT   repeat_region   41827..41859
FT                   /note="2.4 copies 14 mer TATCTAAAGGTTTG 50% conserved"
FT   repeat_region   41938..41949
FT                   /note="2.0 copies 6 mer ACTCTG 24% conserved"
FT   repeat_region   42377..42435
FT                   /note="29.5 copies 2 mer TA 118% conserved"
FT   repeat_region   42601..42614
FT                   /note="3.5 copies 4 mer AAGA 28% conserved"
FT   repeat_region   42798..42817
FT                   /note="20.0 copies 1 mer A 40% conserved"
FT   repeat_region   42987..43019
FT                   /note="6.6 copies 5 mer AGTTC 48% conserved"
FT   repeat_region   43280..43315
FT                   /note="18.0 copies 2 mer GT 45% conserved"
FT   repeat_region   44481..44734
FT                   /note="127.0 copies 2 mer TA 328% conserved"
FT   repeat_region   45179..45200
FT                   /note="3.1 copies 7 mer TGTTTTT 35% conserved"
FT   repeat_region   45183..45198
FT                   /note="2.7 copies 6 mer TTTTGG 23% conserved"
FT   repeat_region   45332..45342
FT                   /note="2.2 copies 5 mer GTTAG 22% conserved"
FT   repeat_region   45870..45881
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   46384..46394
FT                   /note="2.2 copies 5 mer TTAGA 22% conserved"
FT   repeat_region   46652..46680
FT                   /note="7.2 copies 4 mer TTCA 24% conserved"
FT   repeat_region   46660..46689
FT                   /note="3.8 copies 8 mer TTATTTAT 51% conserved"
FT   repeat_region   46683..46727
FT                   /note="7.5 copies 6 mer TTTATT 36% conserved"
FT   repeat_region   46776..46820
FT                   /note="7.5 copies 6 mer TTTTTA 27% conserved"
FT   repeat_region   46819..46829
FT                   /note="2.8 copies 4 mer TTCA 22% conserved"
FT   repeat_region   47190..47218
FT                   /note="5.8 copies 5 mer TTTAT 49% conserved"
FT   repeat_region   47256..47270
FT                   /note="3.8 copies 4 mer TTTA 21% conserved"
FT   repeat_region   47269..47309
FT                   /note="10.2 copies 4 mer TTTG 59% conserved"
FT   repeat_region   47329..47381
FT                   /note="7.6 copies 7 mer TTTTTTA 27% conserved"
FT   repeat_region   47348..47363
FT                   /note="4.0 copies 4 mer TTTC 25% conserved"
FT   repeat_region   47404..47418
FT                   /note="3.8 copies 4 mer TTTG 30% conserved"
FT   repeat_region   47447..47471
FT                   /note="3.1 copies 8 mer TTATTTCA 34% conserved"
FT   repeat_region   47541..47575
FT                   /note="8.8 copies 4 mer TTTA 34% conserved"
FT   repeat_region   47586..47684
FT                   /note="24.8 copies 4 mer CTTT 191% conserved"
FT   repeat_region   47739..47767
FT                   /note="7.2 copies 4 mer CTTT 33% conserved"
FT   repeat_region   47743..47767
FT                   /note="3.1 copies 8 mer TTTCATTC 41% conserved"
FT   repeat_region   47782..47804
FT                   /note="5.8 copies 4 mer TCTT 21% conserved"
FT   repeat_region   48749..48764
FT                   /note="16.0 copies 1 mer T 32% conserved"
FT   repeat_region   49486..49525
FT                   /note="13.3 copies 3 mer ATT 25% conserved"
FT   repeat_region   49524..49549
FT                   /note="8.7 copies 3 mer TAG 52% conserved"
FT   repeat_region   49548..49560
FT                   /note="3.2 copies 4 mer TATT 26% conserved"
FT   repeat_region   49550..49581
FT                   /note="6.4 copies 5 mer TTTAT 32% conserved"
FT   repeat_region   49714..49725
FT                   /note="2.0 copies 6 mer TATTAA 24% conserved"
FT   repeat_region   49896..49915
FT                   /note="2.2 copies 9 mer AAGAATAAA 31% conserved"
FT   repeat_region   49923..49932
FT                   /note="2.5 copies 4 mer AATG 20% conserved"
FT   repeat_region   49950..49962
FT                   /note="3.2 copies 4 mer TACT 26% conserved"
FT   repeat_region   50229..50242
FT                   /note="7.0 copies 2 mer TA 28% conserved"
FT   repeat_region   50246..50279
FT                   /note="2.3 copies 15 mer TTTTTTTACTTTTAC 68% conserved"
FT   repeat_region   50249..50280
FT                   /note="5.3 copies 6 mer TTTTAC 43% conserved"
FT   repeat_region   50255..50273
FT                   /note="2.1 copies 9 mer TTTTACTTT 38% conserved"
FT   repeat_region   50277..50307
FT                   /note="3.4 copies 9 mer TTTATTTCC 37% conserved"
FT   repeat_region   50281..50295
FT                   /note="3.8 copies 4 mer TTTC 21% conserved"
FT   repeat_region   50559..50576
FT                   /note="3.6 copies 5 mer AATTT 36% conserved"
FT   repeat_region   50783..50793
FT                   /note="2.8 copies 4 mer AAAC 22% conserved"
FT   repeat_region   50821..50839
FT                   /note="4.8 copies 4 mer TTTA 38% conserved"
FT   repeat_region   50892..50905
FT                   /note="14.0 copies 1 mer A 28% conserved"
FT   repeat_region   51513..51525
FT                   /note="3.2 copies 4 mer AACA 26% conserved"
FT   repeat_region   51543..51557
FT                   /note="3.8 copies 4 mer AATG 21% conserved"
FT   repeat_region   51616..51634
FT                   /note="2.1 copies 9 mer TAACACATT 29% conserved"
FT   repeat_region   51668..51714
FT                   /note="2.0 copies 24 mer CGAATGAACAACACATTTAGAACT 67%
FT                   conserved"
FT   repeat_region   51669..51678
FT                   /note="2.5 copies 4 mer GAAT 20% conserved"
FT   repeat_region   51712..51725
FT                   /note="3.5 copies 4 mer AACA 28% conserved"
FT   repeat_region   51730..51744
FT                   /note="2.1 copies 7 mer ACATTTG 30% conserved"
FT   repeat_region   51737..51795
FT                   /note="1.9 copies 31 mer ACATTTGAAACGAACAAACAACACATTTCAA
FT                   84% conserved"
FT   repeat_region   51798..51811
FT                   /note="3.5 copies 4 mer AACA 28% conserved"
FT   repeat_region   51830..51839
FT                   /note="2.5 copies 4 mer GAAT 20% conserved"
FT   repeat_region   51837..51856
FT                   /note="2.2 copies 9 mer TGACACATT 40% conserved"
FT   repeat_region   51843..51940
FT                   /note="3.2 copies 31 mer ATTTGACACATTTGGAAGTAACAAACAACAT
FT                   144% conserved"
FT   repeat_region   51901..51918
FT                   /note="2.0 copies 9 mer ACACATTTG 36% conserved"
FT   repeat_region   51942..52040
FT                   /note="3.8 copies 26 mer AACAAACAAACGACACATTTGGAACA 101%
FT                   conserved"
FT   repeat_region   52020..52030
FT                   /note="2.8 copies 4 mer AACA 22% conserved"
FT   repeat_region   52076..52091
FT                   /note="4.0 copies 4 mer AAAC 25% conserved"
FT   repeat_region   52138..52156
FT                   /note="4.8 copies 4 mer GGAA 38% conserved"
FT   repeat_region   52193..52212
FT                   /note="2.2 copies 9 mer GACACATTT 40% conserved"
FT   repeat_region   52256..52268
FT                   /note="3.2 copies 4 mer ACAA 26% conserved"
FT   repeat_region   52315..52328
FT                   /note="2.0 copies 7 mer ACACATT 28% conserved"
FT   repeat_region   52403..52412
FT                   /note="2.5 copies 4 mer AATG 20% conserved"
FT   repeat_region   52430..52448
FT                   /note="2.1 copies 9 mer GACACATTT 29% conserved"
FT   repeat_region   52493..52519
FT                   /note="3.4 copies 8 mer TTTTATAG 45% conserved"
FT   repeat_region   52547..52569
FT                   /note="2.3 copies 10 mer TGTTTTATTC 46% conserved"
FT   repeat_region   52586..52596
FT                   /note="2.2 copies 5 mer TAAAA 22% conserved"
FT   repeat_region   52842..52854
FT                   /note="2.6 copies 5 mer AAGTC 26% conserved"
FT   repeat_region   52863..52873
FT                   /note="2.8 copies 4 mer TATT 22% conserved"
FT   repeat_region   53633..53643
FT                   /note="2.8 copies 4 mer AAAT 22% conserved"
FT   repeat_region   53690..53700
FT                   /note="2.2 copies 5 mer TATAA 22% conserved"
FT   repeat_region   53832..53844
FT                   /note="2.6 copies 5 mer AAACA 26% conserved"
FT   repeat_region   53988..54003
FT                   /note="16.0 copies 1 mer A 23% conserved"
FT   repeat_region   54176..54188
FT                   /note="2.2 copies 6 mer CAGTTT 26% conserved"
FT   repeat_region   54255..54264
FT                   /note="2.5 copies 4 mer TCAA 20% conserved"
FT   repeat_region   54348..54381
FT                   /note="2.6 copies 13 mer GACGTTTTTTGTC 43% conserved"
FT   repeat_region   54928..54941
FT                   /note="2.0 copies 7 mer TGGGGAC 28% conserved"
FT   repeat_region   54972..55050
FT                   /note="39.5 copies 2 mer TA 158% conserved"
FT   repeat_region   55114..55130
FT                   /note="3.4 copies 5 mer ATTAA 25% conserved"
FT   repeat_region   55183..55199
FT                   /note="5.7 copies 3 mer ATT 34% conserved"
FT   repeat_region   55184..55217
FT                   /note="6.8 copies 5 mer TTATT 23% conserved"
FT   repeat_region   55329..55342
FT                   /note="2.3 copies 6 mer AATTAT 28% conserved"
FT   repeat_region   56950..56968
FT                   /note="2.1 copies 9 mer ACATAAAGA 29% conserved"
FT   repeat_region   56995..57012
FT                   /note="3.6 copies 5 mer ATTCA 36% conserved"
FT   repeat_region   57093..57125
FT                   /note="6.6 copies 5 mer TAAAA 32% conserved"
FT   repeat_region   57107..57117
FT                   /note="2.8 copies 4 mer AAAT 22% conserved"
FT   repeat_region   58066..58082
FT                   /note="2.4 copies 7 mer ATACTGG 34% conserved"
FT   repeat_region   58216..58226
FT                   /note="2.2 copies 5 mer TGAAT 22% conserved"
FT   repeat_region   58988..59006
FT                   /note="4.8 copies 4 mer TTAT 29% conserved"
FT   repeat_region   59033..59044
FT                   /note="2.4 copies 5 mer ATTGA 24% conserved"
FT   repeat_region   59059..59074
FT                   /note="3.2 copies 5 mer TTTTG 25% conserved"
FT   repeat_region   59060..59070
FT                   /note="2.8 copies 4 mer TTTG 22% conserved"
FT   repeat_region   59288..59297
FT                   /note="3.3 copies 3 mer TCA 20% conserved"
FT   repeat_region   59479..59535
FT                   /note="3.0 copies 19 mer GGTGCTCCTAAATATTTTT 78% conserved"
FT   repeat_region   59836..59850
FT                   /note="15.0 copies 1 mer T 30% conserved"
FT   repeat_region   59852..59867
FT                   /note="2.3 copies 7 mer TTAAACT 23% conserved"
FT   repeat_region   60091..60105
FT                   /note="2.5 copies 6 mer AAAAAC 21% conserved"
FT   repeat_region   60971..60983
FT                   /note="4.3 copies 3 mer ATC 26% conserved"
FT   repeat_region   61484..61535
FT                   /note="17.3 copies 3 mer TAT 68% conserved"
FT   repeat_region   61575..61605
FT                   /note="10.3 copies 3 mer TAA 62% conserved"
FT   repeat_region   61610..61795
FT                   /note="62.0 copies 3 mer TAT 211% conserved"
FT   repeat_region   61660..61678
FT                   /note="19.0 copies 1 mer T 20% conserved"
FT   repeat_region   62029..62078
FT                   /note="3.3 copies 15 mer AATAGAATACAATAC 64% conserved"
FT   repeat_region   62035..62078
FT                   /note="8.8 copies 5 mer AATAC 61% conserved"
FT   repeat_region   62545..62554
FT                   /note="2.5 copies 4 mer AACA 20% conserved"
FT   repeat_region   62557..62574
FT                   /note="4.5 copies 4 mer AATG 27% conserved"
FT   repeat_region   62592..62617
FT                   /note="6.5 copies 4 mer AATA 25% conserved"
FT   repeat_region   63034..63071
FT                   /note="19.0 copies 2 mer AT 76% conserved"
FT   repeat_region   63071..63105
FT                   /note="35.0 copies 1 mer T 70% conserved"
FT   repeat_region   63117..63127
FT                   /note="2.2 copies 5 mer TGTCA 22% conserved"
FT   repeat_region   63594..63609
FT                   /note="2.0 copies 8 mer CTGTCAGA 32% conserved"
FT   repeat_region   63616..63627
FT                   /note="2.0 copies 6 mer TGTTCC 24% conserved"
FT   repeat_region   63896..63905
FT                   /note="2.5 copies 4 mer ATTA 20% conserved"
FT   repeat_region   63959..63970
FT                   /note="3.0 copies 4 mer TTTA 24% conserved"
FT   repeat_region   64025..64038
FT                   /note="2.3 copies 6 mer CTCAAA 28% conserved"
FT   repeat_region   64534..64544
FT                   /note="2.2 copies 5 mer TCATT 22% conserved"
FT   repeat_region   64713..64730
FT                   /note="6.0 copies 3 mer ATA 20% conserved"
FT   repeat_region   64845..64863
FT                   /note="2.4 copies 8 mer AATTAAGA 29% conserved"
FT   repeat_region   64869..64878
FT                   /note="2.5 copies 4 mer AATG 20% conserved"
FT   repeat_region   64904..64948
FT                   /note="3.2 copies 14 mer AAAAACAAATAAAT 72% conserved"
FT   repeat_region   64910..64950
FT                   /note="10.2 copies 4 mer AAAT 36% conserved"
FT   repeat_region   64914..64940
FT                   /note="4.5 copies 6 mer AAATAA 27% conserved"
FT   repeat_region   64960..64969
FT                   /note="5.0 copies 2 mer AT 20% conserved"
FT   repeat_region   64976..65041
FT                   /note="33.0 copies 2 mer AT 132% conserved"
FT   repeat_region   65692..65738
FT                   /note="11.8 copies 4 mer TATT 67% conserved"
FT   repeat_region   65693..65738
FT                   /note="3.8 copies 12 mer ATTTATTTATTC 74% conserved"
FT   repeat_region   65769..65786
FT                   /note="2.0 copies 9 mer TTTTTACCA 36% conserved"
FT   repeat_region   65840..65851
FT                   /note="2.4 copies 5 mer GTTTT 24% conserved"
FT   repeat_region   65883..65901
FT                   /note="1.9 copies 10 mer TGATGTATCA 29% conserved"
FT   repeat_region   65932..65943
FT                   /note="3.0 copies 4 mer CATG 24% conserved"
FT   repeat_region   66062..66072
FT                   /note="2.8 copies 4 mer TGTT 22% conserved"
FT   repeat_region   66320..66334
FT                   /note="2.1 copies 7 mer TTCATAA 30% conserved"
FT   repeat_region   66487..66499
FT                   /note="13.0 copies 1 mer T 26% conserved"
FT   repeat_region   66630..66646
FT                   /note="3.4 copies 5 mer TTTTC 27% conserved"
FT   repeat_region   66681..66695
FT                   /note="15.0 copies 1 mer T 30% conserved"
FT   repeat_region   66823..66849
FT                   /note="27.0 copies 1 mer T 27% conserved"
FT   repeat_region   67216..67231
FT                   /note="2.7 copies 6 mer AAGTAA 23% conserved"
FT   repeat_region   67498..67516
FT                   /note="3.2 copies 6 mer GATACT 29% conserved"
FT   repeat_region   67708..67722
FT                   /note="2.1 copies 7 mer CTCCATG 30% conserved"
FT   repeat_region   68119..68137
FT                   /note="2.1 copies 9 mer AGTGTGTGC 29% conserved"
FT   repeat_region   68384..68451
FT                   /note="34.0 copies 2 mer CA 136% conserved"
FT   repeat_region   68571..68580
FT                   /note="2.0 copies 5 mer AGATT 20% conserved"
FT   repeat_region   68608..68620
FT                   /note="2.6 copies 5 mer AAAAT 26% conserved"
FT   repeat_region   68629..68643
FT                   /note="3.8 copies 4 mer TTAA 21% conserved"
FT   repeat_region   69009..69048
FT                   /note="20.0 copies 2 mer TA 23% conserved"
FT   repeat_region   69031..69045
FT                   /note="3.0 copies 5 mer ATATA 21% conserved"
FT   repeat_region   69153..69165
FT                   /note="2.2 copies 6 mer CGAAAG 26% conserved"
FT   repeat_region   69653..69669
FT                   /note="4.2 copies 4 mer TGAA 34% conserved"
FT   repeat_region   69834..69845
FT                   /note="2.0 copies 6 mer CGCGCC 24% conserved"
FT   repeat_region   70554..70565
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   70748..70759
FT                   /note="2.4 copies 5 mer AAAGT 24% conserved"
FT   repeat_region   70784..70794
FT                   /note="3.7 copies 3 mer ATT 22% conserved"
FT   repeat_region   71467..71478
FT                   /note="2.0 copies 6 mer TGAATG 24% conserved"
FT   repeat_region   71479..71525
FT                   /note="5.2 copies 9 mer ATTTTATTT 62% conserved"
FT   repeat_region   71674..71684
FT                   /note="3.7 copies 3 mer TTA 22% conserved"
FT   repeat_region   71700..71807
FT                   /note="21.6 copies 5 mer AATTT 171% conserved"
FT   repeat_region   71790..71803
FT                   /note="2.0 copies 7 mer AATTTAA 28% conserved"
FT   repeat_region   71854..71865
FT                   /note="3.0 copies 4 mer CAGG 24% conserved"
FT   repeat_region   71894..71904
FT                   /note="2.8 copies 4 mer AAAT 22% conserved"
FT   repeat_region   71918..71929
FT                   /note="2.0 copies 6 mer TTAAAT 24% conserved"
FT   repeat_region   71956..71968
FT                   /note="6.5 copies 2 mer TG 26% conserved"
FT   repeat_region   72342..72354
FT                   /note="13.0 copies 1 mer A 26% conserved"
FT   repeat_region   72857..72876
FT                   /note="2.0 copies 10 mer TAATCACATT 33% conserved"
FT   repeat_region   73046..73057
FT                   /note="2.4 copies 5 mer ATTTA 24% conserved"
FT   repeat_region   73216..73233
FT                   /note="2.2 copies 8 mer CAATAACT 27% conserved"
FT   repeat_region   73506..73522
FT                   /note="5.7 copies 3 mer TTA 25% conserved"
FT   repeat_region   74149..74171
FT                   /note="3.3 copies 7 mer TTTTATA 39% conserved"
FT   repeat_region   74150..74174
FT                   /note="4.2 copies 6 mer TTTATA 41% conserved"
FT   repeat_region   74246..74259
FT                   /note="14.0 copies 1 mer A 28% conserved"
FT   repeat_region   74642..74652
FT                   /note="2.2 copies 5 mer AAAAC 22% conserved"
FT   repeat_region   74877..74908
FT                   /note="8.0 copies 4 mer AAAT 48% conserved"
FT   repeat_region   74900..74917
FT                   /note="3.6 copies 5 mer AAATT 27% conserved"
FT   repeat_region   75225..75243
FT                   /note="3.2 copies 6 mer TATTTT 24% conserved"
FT   repeat_region   75229..75239
FT                   /note="2.8 copies 4 mer TTTA 22% conserved"
FT   repeat_region   75763..75778
FT                   /note="2.0 copies 8 mer TGCTGGTT 32% conserved"
FT   repeat_region   75773..75798
FT                   /note="2.4 copies 11 mer CTGGTTCTTTA 45% conserved"
FT   repeat_region   76002..76012
FT                   /note="2.2 copies 5 mer TAGTA 22% conserved"
FT   repeat_region   76192..76212
FT                   /note="1.9 copies 11 mer CATGTTATTAG 35% conserved"
FT   repeat_region   76552..76561
FT                   /note="2.5 copies 4 mer TTTA 20% conserved"
FT   repeat_region   76862..76874
FT                   /note="2.2 copies 6 mer TTCCCC 26% conserved"
FT   repeat_region   77157..77167
FT                   /note="2.2 copies 5 mer TTGTT 22% conserved"
FT   repeat_region   77340..77353
FT                   /note="2.0 copies 7 mer AGTGAAG 28% conserved"
FT   repeat_region   78172..78189
FT                   /note="3.6 copies 5 mer TTATT 27% conserved"
FT   repeat_region   78183..78206
FT                   /note="2.7 copies 9 mer TAATTTAAA 39% conserved"
FT   repeat_region   78186..78206
FT                   /note="2.1 copies 10 mer TTTAAATAAT 42% conserved"
FT   repeat_region   78203..78213
FT                   /note="2.2 copies 5 mer AATTG 22% conserved"
FT   repeat_region   78219..78234
FT                   /note="4.0 copies 4 mer TTTA 25% conserved"
FT   repeat_region   78275..78284
FT                   /note="3.3 copies 3 mer ATG 20% conserved"
FT   repeat_region   78299..78318
FT                   /note="6.7 copies 3 mer ATT 24% conserved"
FT   repeat_region   78303..78320
FT                   /note="3.6 copies 5 mer TTATT 27% conserved"
FT   repeat_region   78306..78321
FT                   /note="2.7 copies 6 mer TTTTAT 32% conserved"
FT   repeat_region   78334..78348
FT                   /note="2.5 copies 6 mer AGTAAT 21% conserved"
FT   repeat_region   78389..78398
FT                   /note="10.0 copies 1 mer T 20% conserved"
FT   repeat_region   78429..78473
FT                   /note="11.2 copies 4 mer TTTA 90% conserved"
FT   repeat_region   78519..78536
FT                   /note="6.0 copies 3 mer ATA 27% conserved"
FT   repeat_region   78520..78533
FT                   /note="2.0 copies 7 mer TAATAAT 28% conserved"
FT   repeat_region   78743..78753
FT                   /note="11.0 copies 1 mer T 22% conserved"
FT   repeat_region   79274..79284
FT                   /note="11.0 copies 1 mer A 22% conserved"
FT   repeat_region   79401..79724
FT                   /note="8.1 copies 40 mer
FT                   CTGAACAAAAAATATCATGTTCACCCAACAAGATATTTTT 384% conserved"
FT   repeat_region   79561..79722
FT                   /note="7.4 copies 22 mer CAACAAGATATTTTTGTTTACT 84%
FT                   conserved"
FT   repeat_region   79562..79632
FT                   /note="3.2 copies 22 mer AACAAGATATTTTTGTTTGCTG 83%
FT                   conserved"
FT   repeat_region   80878..80891
FT                   /note="2.0 copies 7 mer TATAATA 28% conserved"
FT   repeat_region   81814..81827
FT                   /note="2.0 copies 7 mer TATTTTC 28% conserved"
FT   repeat_region   81925..81936
FT                   /note="2.0 copies 6 mer AATTAA 24% conserved"
FT   repeat_region   82061..82070
FT                   /note="10.0 copies 1 mer A 20% conserved"
FT   repeat_region   82285..82368
FT                   /note="42.0 copies 2 mer AT 168% conserved"
FT   repeat_region   82367..82380
FT                   /note="2.3 copies 6 mer ATGTAA 28% conserved"
FT   repeat_region   82426..82436
FT                   /note="3.7 copies 3 mer ATA 22% conserved"
FT   repeat_region   82709..82719
FT                   /note="2.8 copies 4 mer AAAG 22% conserved"
FT   repeat_region   83238..83247
FT                   /note="2.5 copies 4 mer ACAT 20% conserved"
FT   repeat_region   83732..83750
FT                   /note="3.2 copies 6 mer TTGGGT 29% conserved"
FT   repeat_region   83758..83773
FT                   /note="3.2 copies 5 mer AATAA 23% conserved"
FT   repeat_region   84313..84323
FT                   /note="2.8 copies 4 mer AGAA 22% conserved"
FT   repeat_region   85085..85103
FT                   /note="3.2 copies 6 mer ATAAAA 38% conserved"
FT   repeat_region   85247..85256
FT                   /note="10.0 copies 1 mer T 20% conserved"
FT   repeat_region   85968..85987
FT                   /note="2.2 copies 9 mer CTACTAATA 40% conserved"
FT   repeat_region   86115..86137
FT                   /note="3.8 copies 6 mer TAAATG 46% conserved"
FT   repeat_region   86135..86149
FT                   /note="5.0 copies 3 mer AAT 21% conserved"
FT   repeat_region   87073..87093
FT                   /note="4.2 copies 5 mer ATTCT 42% conserved"
FT   repeat_region   87149..87171
FT                   /note="11.5 copies 2 mer TG 28% conserved"
FT   repeat_region   87179..87196
FT                   /note="2.6 copies 7 mer ACATAAT 29% conserved"
FT   repeat_region   87217..87226
FT                   /note="10.0 copies 1 mer A 20% conserved"
FT   repeat_region   87272..87287
FT                   /note="2.0 copies 8 mer GTTATTTT 32% conserved"
FT   repeat_region   87363..87374
FT                   /note="12.0 copies 1 mer T 24% conserved"
FT   repeat_region   87462..87518
FT                   /note="19.0 copies 3 mer TAT 114% conserved"
FT   repeat_region   87552..87561
FT                   /note="2.5 copies 4 mer TTAT 20% conserved"
FT   repeat_region   87590..87610
FT                   /note="2.1 copies 10 mer TGTGTAATAT 33% conserved"
FT   repeat_region   87635..87645
FT                   /note="11.0 copies 1 mer T 22% conserved"
FT   repeat_region   87880..87889
FT                   /note="10.0 copies 1 mer A 20% conserved"
FT   repeat_region   87887..87900
FT                   /note="3.5 copies 4 mer AAAT 28% conserved"
FT   repeat_region   87896..87921
FT                   /note="8.7 copies 3 mer AAT 52% conserved"
FT   repeat_region   88165..88175
FT                   /note="2.2 copies 5 mer AGCAG 22% conserved"
FT   repeat_region   88911..88929
FT                   /note="2.4 copies 8 mer TTAAAAAA 29% conserved"
FT   repeat_region   89243..89292
FT                   /note="25.0 copies 2 mer AT 100% conserved"
FT   repeat_region   89502..89523
FT                   /note="5.5 copies 4 mer TAAA 28% conserved"
FT   repeat_region   89871..89881
FT                   /note="2.8 copies 4 mer ATAA 22% conserved"
FT   repeat_region   90100..90129
FT                   /note="15.0 copies 2 mer TC 42% conserved"
FT   repeat_region   90139..90151
FT                   /note="2.2 copies 6 mer AGCTTC 26% conserved"
FT   repeat_region   90293..90308
FT                   /note="2.3 copies 7 mer AGGTCAC 32% conserved"
FT   repeat_region   90378..90390
FT                   /note="6.5 copies 2 mer GT 26% conserved"
FT   repeat_region   90745..90755
FT                   /note="2.8 copies 4 mer GATG 22% conserved"
FT   repeat_region   90797..90807
FT                   /note="11.0 copies 1 mer A 22% conserved"
FT   repeat_region   91057..91077
FT                   /note="1.9 copies 11 mer CTTTATTAAAA 42% conserved"
FT   repeat_region   91238..91248
FT                   /note="2.8 copies 4 mer ATAA 22% conserved"
FT   repeat_region   91536..91546
FT                   /note="2.8 copies 4 mer TATG 22% conserved"
FT   repeat_region   91623..91644
FT                   /note="22.0 copies 1 mer T 26% conserved"
FT   repeat_region   91809..91828
FT                   /note="2.0 copies 10 mer GAGTTATAAT 33% conserved"
FT   repeat_region   91825..91838
FT                   /note="2.3 copies 6 mer AATGTA 28% conserved"
FT   repeat_region   92085..92105
FT                   /note="1.9 copies 11 mer GGGAGTCAGAG 42% conserved"
FT   repeat_region   92839..92850
FT                   /note="2.0 copies 6 mer AATGTT 24% conserved"
FT   repeat_region   93412..93437
FT                   /note="26.0 copies 1 mer T 52% conserved"
FT   repeat_region   94112..94121
FT                   /note="2.5 copies 4 mer ATGA 20% conserved"
FT   repeat_region   94231..94243
FT                   /note="2.2 copies 6 mer GACGCT 26% conserved"
FT   repeat_region   94476..94485
FT                   /note="2.5 copies 4 mer TTCT 20% conserved"
FT   repeat_region   94562..94579
FT                   /note="2.6 copies 7 mer CCTACAA 27% conserved"
FT   repeat_region   94729..94738
FT                   /note="2.0 copies 5 mer TTCAG 20% conserved"
FT   repeat_region   94899..94938
FT                   /note="2.0 copies 20 mer AAAAAAATAGATGGATGGAA 62%
FT                   conserved"
FT   repeat_region   94905..94917
FT                   /note="3.2 copies 4 mer ATGG 26% conserved"
FT   repeat_region   94929..94974
FT                   /note="11.5 copies 4 mer GATG 74% conserved"
FT   repeat_region   94977..94988
FT                   /note="3.0 copies 4 mer AAAT 24% conserved"
FT   repeat_region   94985..95008
FT                   /note="2.7 copies 9 mer AAATGGATG 32% conserved"
FT   repeat_region   95016..95025
FT                   /note="2.5 copies 4 mer AAGA 20% conserved"
FT   repeat_region   95025..96012
FT                   /note="247.0 copies 4 mer ATGG 266% conserved"
FT   repeat_region   95109..95195
FT                   /note="2.6 copies 33 mer ATGGATGGATGGATGGATGGACAAAAGAAATAA
FT                   102% conserved"
FT   repeat_region   95271..95304
FT                   /note="2.0 copies 17 mer AGATGGATGGATGAAAA 59% conserved"
FT   repeat_region   95759..95791
FT                   /note="1.9 copies 17 mer AAAAGATGGATGGATGA 57% conserved"
FT   repeat_region   96030..96045
FT                   /note="2.0 copies 8 mer AGATGAAT 32% conserved"
FT   repeat_region   96095..96114
FT                   /note="5.0 copies 4 mer GAAA 40% conserved"
FT   repeat_region   96133..96155
FT                   /note="5.8 copies 4 mer AGAC 46% conserved"
FT   repeat_region   96155..96165
FT                   /note="2.8 copies 4 mer ATAA 22% conserved"
FT   repeat_region   97031..97040
FT                   /note="2.5 copies 4 mer CATG 20% conserved"
FT   repeat_region   97696..97720
FT                   /note="5.0 copies 5 mer CAAGG 34% conserved"
FT   repeat_region   97911..97922
FT                   /note="2.0 copies 6 mer TGGTGA 24% conserved"
FT   repeat_region   98924..98933
FT                   /note="2.5 copies 4 mer AATA 20% conserved"
FT   repeat_region   99425..99438
FT                   /note="2.8 copies 5 mer AAAAT 28% conserved"
FT   repeat_region   99498..99517
FT                   /note="2.0 copies 10 mer CTACTTTTTT 40% conserved"
FT   repeat_region   99688..99699
FT                   /note="2.4 copies 5 mer ATGTC 24% conserved"
FT   repeat_region   99770..99780
FT                   /note="2.8 copies 4 mer AAAG 22% conserved"
FT   repeat_region   99843..99852
FT                   /note="2.5 copies 4 mer TGTT 20% conserved"
FT   repeat_region   100184..100195
FT                   /note="2.0 copies 6 mer TTTTGG 24% conserved"
FT   repeat_region   100594..100607
FT                   /note="14.0 copies 1 mer T 28% conserved"
FT   repeat_region   100666..100676
FT                   /note="2.2 copies 5 mer AGAAA 22% conserved"
FT   repeat_region   100756..100765
FT                   /note="3.3 copies 3 mer TTC 20% conserved"
FT   repeat_region   101019..101033
FT                   /note="5.0 copies 3 mer CAG 21% conserved"
FT   repeat_region   101023..101034
FT                   /note="2.0 copies 6 mer AGCAGA 24% conserved"
FT   repeat_region   101300..101320
FT                   /note="4.2 copies 5 mer AAAAC 33% conserved"
FT   repeat_region   101302..101317
FT                   /note="5.3 copies 3 mer AAC 25% conserved"
FT   repeat_region   101588..101599
FT                   /note="2.0 copies 6 mer TGTATT 24% conserved"
FT   repeat_region   101655..101666
FT                   /note="6.0 copies 2 mer CA 24% conserved"
FT   repeat_region   101929..101945
FT                   /note="5.7 copies 3 mer TGA 25% conserved"
FT   repeat_region   101932..101945
FT                   /note="2.0 copies 7 mer TGATGAT 28% conserved"
FT   repeat_region   102277..102304
FT                   /note="3.5 copies 8 mer AAGAAGTG 29% conserved"
FT   repeat_region   102287..102304
FT                   /note="3.6 copies 5 mer GAAGT 27% conserved"
FT   repeat_region   102313..102323
FT                   /note="11.0 copies 1 mer T 22% conserved"
FT   repeat_region   102619..102637
FT                   /note="19.0 copies 1 mer T 20% conserved"
FT   repeat_region   102622..102635
FT                   /note="2.8 copies 5 mer TTTTC 28% conserved"
FT   repeat_region   102645..102656
FT                   /note="2.4 copies 5 mer CTCAC 24% conserved"
FT   repeat_region   102686..102699
FT                   /note="2.0 copies 7 mer TCATCTT 28% conserved"
FT   repeat_region   102696..102706
FT                   /note="2.2 copies 5 mer TCTTG 22% conserved"
FT   repeat_region   102736..102746
FT                   /note="2.2 copies 5 mer TCTGG 22% conserved"
FT   repeat_region   102817..102827
FT                   /note="2.2 copies 5 mer ATCTC 22% conserved"
FT   repeat_region   102868..102890
FT                   /note="4.6 copies 5 mer TCTCA 37% conserved"
FT   repeat_region   103088..103098
FT                   /note="2.2 copies 5 mer TCTCA 22% conserved"
FT   repeat_region   103151..103165
FT                   /note="3.0 copies 5 mer ATTTC 21% conserved"
FT   repeat_region   103233..103243
FT                   /note="2.2 copies 5 mer TCCTC 22% conserved"
FT   repeat_region   103247..103259
FT                   /note="2.2 copies 6 mer TTTCTC 26% conserved"
FT   repeat_region   103362..103387
FT                   /note="5.2 copies 5 mer CTTCT 25% conserved"
FT   repeat_region   103417..103452
FT                   /note="3.0 copies 12 mer ATCTAGTCTCTT 36% conserved"
FT   repeat_region   103423..103439
FT                   /note="3.4 copies 5 mer TCTCT 27% conserved"
FT   repeat_region   103466..103499
FT                   /note="2.8 copies 12 mer TTCTCATTTCTC 34% conserved"
FT   repeat_region   103499..103517
FT                   /note="3.8 copies 5 mer TTCTT 29% conserved"
FT   repeat_region   103517..103555
FT                   /note="2.6 copies 15 mer TCTTTTCATATAGTT 51% conserved"
FT   repeat_region   103629..103645
FT                   /note="2.4 copies 7 mer TCTCTTC 34% conserved"
FT   repeat_region   103636..103654
FT                   /note="3.8 copies 5 mer TCTCT 38% conserved"
FT   repeat_region   103660..103671
FT                   /note="2.0 copies 6 mer TATTCT 24% conserved"
FT   repeat_region   103677..103721
FT                   /note="6.4 copies 7 mer CTTCTCT 36% conserved"
FT   repeat_region   103688..103711
FT                   /note="2.4 copies 10 mer GTCTTTTCTC 32% conserved"
FT   repeat_region   103689..103716
FT                   /note="5.6 copies 5 mer TCTCT 26% conserved"
FT   repeat_region   103717..103750
FT                   /note="3.4 copies 10 mer TTCTCATATA 50% conserved"
FT   repeat_region   103747..103832
FT                   /note="17.2 copies 5 mer TTCTC 32% conserved"
FT   repeat_region   103828..103861
FT                   /note="3.4 copies 10 mer TTCTCATATA 41% conserved"
FT   repeat_region   103845..103862
FT                   /note="2.2 copies 8 mer TTATATTC 27% conserved"
FT   repeat_region   103866..103903
FT                   /note="2.5 copies 15 mer TCTTCTCATCTAGTC 58% conserved"
FT   repeat_region   103869..103903
FT                   /note="7.0 copies 5 mer TCTCA 27% conserved"
FT   repeat_region   103879..103902
FT                   /note="2.4 copies 10 mer TCTCTTCTCA 39% conserved"
FT   repeat_region   103934..103957
FT                   /note="2.4 copies 10 mer TCTCATCTAG 30% conserved"
FT   repeat_region   103980..103989
FT                   /note="3.3 copies 3 mer TAT 20% conserved"
FT   repeat_region   103988..104031
FT                   /note="8.8 copies 5 mer TTCTC 45% conserved"
FT   repeat_region   104027..104047
FT                   /note="2.1 copies 10 mer TTCTCATATA 42% conserved"
FT   repeat_region   104061..104108
FT                   /note="2.4 copies 20 mer TCTCTTCTGATCTAGTCTTT 78%
FT                   conserved"
FT   repeat_region   104150..104176
FT                   /note="2.7 copies 10 mer TATTCTCATG 36% conserved"
FT   repeat_region   104192..104219
FT                   /note="3.5 copies 8 mer TTCTTCTC 31% conserved"
FT   repeat_region   104199..104229
FT                   /note="6.2 copies 5 mer CTTTT 28% conserved"
FT   repeat_region   104202..104223
FT                   /note="7.3 copies 3 mer TTC 23% conserved"
FT   repeat_region   104216..104229
FT                   /note="2.0 copies 7 mer TCTTTTC 28% conserved"
FT   repeat_region   104228..104251
FT                   /note="2.4 copies 10 mer TCATATATTC 30% conserved"
FT   repeat_region   104260..104298
FT                   /note="2.6 copies 15 mer CTCTTCTCATCTAGT 60% conserved"
FT   repeat_region   104264..104298
FT                   /note="7.0 copies 5 mer TCTCA 27% conserved"
FT   repeat_region   104274..104297
FT                   /note="2.4 copies 10 mer TCTCTTCTCA 39% conserved"
FT   repeat_region   104301..104319
FT                   /note="1.9 copies 10 mer TATTCTCATT 29% conserved"
FT   repeat_region   104497..104528
FT                   /note="6.4 copies 5 mer CTCTT 55% conserved"
FT   repeat_region   104543..104574
FT                   /note="3.2 copies 10 mer TTCTATATAT 30% conserved"
FT   repeat_region   104621..104634
FT                   /note="2.8 copies 5 mer TCTCT 28% conserved"
FT   repeat_region   104696..104706
FT                   /note="2.2 copies 5 mer TTTCC 22% conserved"
FT   repeat_region   104717..104728
FT                   /note="2.4 copies 5 mer CTTGT 24% conserved"
FT   repeat_region   104728..104761
FT                   /note="3.4 copies 10 mer TCTCATCTTT 41% conserved"
FT   repeat_region   104767..104776
FT                   /note="2.0 copies 5 mer TTCTC 20% conserved"
FT   repeat_region   105062..105072
FT                   /note="2.2 copies 5 mer AAAAG 22% conserved"
FT   repeat_region   105180..105201
FT                   /note="11.0 copies 2 mer CA 35% conserved"
FT   repeat_region   105486..105498
FT                   /note="2.6 copies 5 mer TCAGA 26% conserved"
FT   repeat_region   106160..106172
FT                   /note="4.3 copies 3 mer ACC 26% conserved"
FT   repeat_region   complement(131..255)
FT                   /note="Dr000028 repeat: matches 36..160 of consensus"
FT   repeat_region   complement(288..327)
FT                   /note="Dr000213 repeat: matches 155..194 of consensus"
FT   repeat_region   complement(332..448)
FT                   /note="Dr000179 repeat: matches 275..391 of consensus"
FT   repeat_region   complement(461..614)
FT                   /note="Dr000028 repeat: matches 8..160 of consensus"
FT   repeat_region   621..679
FT                   /note="Dr000316 repeat: matches 272..328 of consensus"
FT   repeat_region   673..830
FT                   /note="Dr000316 repeat: matches 602..773 of consensus"
FT   repeat_region   complement(622..679)
FT                   /note="TDR13 repeat: matches 456..516 of consensus"
FT   repeat_region   complement(673..829)
FT                   /note="TDR13 repeat: matches 1..172 of consensus"
FT   repeat_region   complement(831..920)
FT                   /note="Dr000067 repeat: matches 104..197 of consensus"
FT   repeat_region   complement(915..979)
FT                   /note="Dr000067 repeat: matches 11..74 of consensus"
FT   repeat_region   complement(1895..1954)
FT                   /note="Dr000300 repeat: matches 217..276 of consensus"
FT   repeat_region   1957..1998
FT                   /note="Dr000033 repeat: matches 373..413 of consensus"
FT   repeat_region   2263..2355
FT                   /note="drr1009 repeat: matches 87..180 of consensus"
FT   repeat_region   complement(2137..2334)
FT                   /note="drr860 repeat: matches 1..199 of consensus"
FT   repeat_region   complement(2754..2820)
FT                   /note="Dr000340 repeat: matches 142..209 of consensus"
FT   repeat_region   2904..2962
FT                   /note="Dr000340 repeat: matches 143..201 of consensus"
FT   repeat_region   complement(2893..2958)
FT                   /note="Dr000340 repeat: matches 144..208 of consensus"
FT   repeat_region   2983..3064
FT                   /note="Dr000340 repeat: matches 126..208 of consensus"
FT   repeat_region   complement(4216..4320)
FT                   /note="Dr000040 repeat: matches 1424..1526 of consensus"
FT   repeat_region   4379..4755
FT                   /note="drr454 repeat: matches 11..385 of consensus"
FT   repeat_region   complement(4217..4755)
FT                   /note="TC1DR2 repeat: matches 313..871 of consensus"
FT   repeat_region   complement(4747..4784)
FT                   /note="TC1DR2 repeat: matches 233..270 of consensus"
FT   repeat_region   4787..5101
FT                   /note="Dr000056 repeat: matches 132..473 of consensus"
FT   repeat_region   complement(5185..5945)
FT                   /note="Dr000240 repeat: matches 288..1090 of consensus"
FT   repeat_region   6051..6287
FT                   /note="drr454 repeat: matches 437..675 of consensus"
FT   repeat_region   complement(6051..6287)
FT                   /note="TC1DR2 repeat: matches 3..243 of consensus"
FT   repeat_region   6761..6965
FT                   /note="Dr000316 repeat: matches 570..774 of consensus"
FT   repeat_region   complement(6752..6963)
FT                   /note="TDR13 repeat: matches 1..213 of consensus"
FT   repeat_region   7809..7876
FT                   /note="Dr000340 repeat: matches 140..208 of consensus"
FT   repeat_region   7875..8191
FT                   /note="TDR18 repeat: matches 2..327 of consensus"
FT   repeat_region   complement(7872..8191)
FT                   /note="Dr000393 repeat: matches 225..549 of consensus"
FT   repeat_region   8215..8296
FT                   /note="TDR18 repeat: matches 484..563 of consensus"
FT   repeat_region   complement(8215..8299)
FT                   /note="Dr000378 repeat: matches 10..94 of consensus"
FT   repeat_region   8423..8476
FT                   /note="Dr000009 repeat: matches 774..827 of consensus"
FT   repeat_region   complement(8751..8995)
FT                   /note="drr759 repeat: matches 110..349 of consensus"
FT   repeat_region   9008..9173
FT                   /note="Dr000350 repeat: matches 203..384 of consensus"
FT   repeat_region   9023..9357
FT                   /note="DANA repeat: matches 25..406 of consensus"
FT   repeat_region   9291..9373
FT                   /note="TDR9 repeat: matches 1..80 of consensus"
FT   repeat_region   complement(9026..9355)
FT                   /note="Dr000396 repeat: matches 1..339 of consensus"
FT   repeat_region   9448..9724
FT                   /note="TDR2 repeat: matches 662..937 of consensus"
FT   repeat_region   complement(9291..9460)
FT                   /note="TDR9 repeat: matches 43..208 of consensus"
FT   repeat_region   complement(9450..9728)
FT                   /note="Dr000006 repeat: matches 202..475 of consensus"
FT   repeat_region   10167..10426
FT                   /note="DANA repeat: matches 1..292 of consensus"
FT   repeat_region   complement(10162..10257)
FT                   /note="Dr000039 repeat: matches 299..394 of consensus"
FT   repeat_region   10432..10548
FT                   /note="Dr000331 repeat: matches 295..415 of consensus"
FT   repeat_region   10439..10515
FT                   /note="DANA repeat: matches 323..404 of consensus"
FT   repeat_region   complement(10175..10514)
FT                   /note="Dr000403 repeat: matches 1..361 of consensus"
FT   repeat_region   complement(10455..10525)
FT                   /note="TDR9 repeat: matches 133..208 of consensus"
FT   repeat_region   complement(10668..10775)
FT                   /note="Dr000148 repeat: matches 5..134 of consensus"
FT   repeat_region   complement(11799..12295)
FT                   /note="Dr000114 repeat: matches 609..1130 of consensus"
FT   repeat_region   complement(12297..12777)
FT                   /note="Dr000354 repeat: matches 11..498 of consensus"
FT   repeat_region   complement(13667..13793)
FT                   /note="Dr000340 repeat: matches 72..198 of consensus"
FT   repeat_region   13840..13956
FT                   /note="Dr000104 repeat: matches 243..366 of consensus"
FT   repeat_region   complement(13789..13848)
FT                   /note="Dr000046 repeat: matches 3912..3970 of consensus"
FT   repeat_region   13866..14070
FT                   /note="DANA repeat: matches 97..292 of consensus"
FT   repeat_region   complement(13866..14139)
FT                   /note="Dr000403 repeat: matches 1..293 of consensus"
FT   repeat_region   15049..15286
FT                   /note="Dr000248 repeat: matches 3..240 of consensus"
FT                   /note="TDR6 repeat: matches 3..249 of consensus"
FT   repeat_region   complement(15291..15426)
FT                   /note="drr506 repeat: matches 74..203 of consensus"
FT   repeat_region   15513..16174
FT                   /note="Dr000209 repeat: matches 1..678 of consensus"
FT   repeat_region   complement(16686..16847)
FT                   /note="Dr000170 repeat: matches 576..727 of consensus"
FT   repeat_region   complement(16830..16990)
FT                   /note="drr841 repeat: matches 1..148 of consensus"
FT   repeat_region   complement(17043..17129)
FT                   /note="drr487 repeat: matches 1..76 of consensus"
FT   repeat_region   complement(17105..17223)
FT                   /note="drr776 repeat: matches 41..158 of consensus"
FT   repeat_region   complement(17255..17353)
FT                   /note="Dr000170 repeat: matches 13..109 of consensus"
FT   repeat_region   17466..17507
FT                   /note="drr506 repeat: matches 85..126 of consensus"
FT   repeat_region   17709..18000
FT                   /note="Dr000073 repeat: matches 22..322 of consensus"
FT   repeat_region   complement(17994..18077)
FT                   /note="Dr000340 repeat: matches 128..212 of consensus"
FT   repeat_region   complement(18599..18717)
FT                   /note="drr499 repeat: matches 1..119 of consensus"
FT   repeat_region   18740..18785
FT                   /note="drr499 repeat: matches 1..46 of consensus"
FT   repeat_region   19556..20181
FT                   /note="Dr000128 repeat: matches 1..647 of consensus"
FT   repeat_region   19557..19981
FT                   /note="TDR13 repeat: matches 1..419 of consensus"
FT   repeat_region   19981..20181
FT                   /note="TDR13 repeat: matches 577..772 of consensus"
FT   repeat_region   20203..21130
FT                   /note="TDR2 repeat: matches 1..937 of consensus"
FT   repeat_region   complement(20207..21129)
FT                   /note="Dr000387 repeat: matches 2..924 of consensus"
FT   repeat_region   complement(21343..21417)
FT                   /note="Dr000340 repeat: matches 91..166 of consensus"
FT   repeat_region   complement(21394..21480)
FT                   /note="Dr000340 repeat: matches 132..219 of consensus"
FT   repeat_region   21480..21547
FT                   /note="Dr000309 repeat: matches 2..69 of consensus"
FT   repeat_region   21547..21943
FT                   /note="Dr000043 repeat: matches 119..507 of consensus"
FT   repeat_region   complement(22568..22665)
FT                   /note="Dr000340 repeat: matches 112..210 of consensus"
FT   repeat_region   23007..24161
FT                   /note="Dr000234 repeat: matches 1..1143 of consensus"
FT   repeat_region   complement(24185..24295)
FT                   /note="Dr000005 repeat: matches 1084..1195 of consensus"
FT   repeat_region   complement(24506..24703)
FT                   /note="Dr000005 repeat: matches 831..1028 of consensus"
FT                   /note="CR1DR1 repeat: matches 3785..3982 of consensus"
FT   repeat_region   complement(24770..24903)
FT                   /note="drr738 repeat: matches 1..138 of consensus"
FT   repeat_region   complement(25518..25676)
FT                   /note="Dr000351 repeat: matches 421..579 of consensus"
FT   repeat_region   complement(25728..26130)
FT                   /note="Dr000351 repeat: matches 11..408 of consensus"
FT   repeat_region   26148..26331
FT                   /note="drr889 repeat: matches 16..189 of consensus"
FT   repeat_region   26340..26702
FT                   /note="Dr000396 repeat: matches 1..362 of consensus"
FT   repeat_region   complement(26330..26405)
FT                   /note="TDR9 repeat: matches 1..76 of consensus"
FT   repeat_region   complement(26338..26706)
FT                   /note="DANA repeat: matches 1..406 of consensus"
FT   repeat_region   complement(26735..26890)
FT                   /note="Dr000183 repeat: matches 1..155 of consensus"
FT   repeat_region   26953..27111
FT                   /note="Dr000391 repeat: matches 621..788 of consensus"
FT   repeat_region   complement(28154..28302)
FT                   /note="Dr000149 repeat: matches 235..395 of consensus"
FT   repeat_region   complement(28421..28559)
FT                   /note="Dr000340 repeat: matches 81..221 of consensus"
FT   repeat_region   complement(28534..28691)
FT                   /note="Dr000149 repeat: matches 1..151 of consensus"
FT   repeat_region   28847..28944
FT                   /note="Dr000331 repeat: matches 1057..1154 of consensus"
FT   repeat_region   28903..28951
FT                   /note="TDR6 repeat: matches 205..248 of consensus"
FT   repeat_region   28912..28951
FT                   /note="Dr000248 repeat: matches 202..239 of consensus"
FT   repeat_region   29021..29693
FT                   /note="Dr000398 repeat: matches 1..701 of consensus"
FT   repeat_region   29023..29519
FT                   /note="Dr000334 repeat: matches 1..483 of consensus"
FT   repeat_region   complement(29021..29533)
FT                   /note="TDR13 repeat: matches 244..772 of consensus"
FT   repeat_region   complement(29492..29694)
FT                   /note="TDR13 repeat: matches 36..247 of consensus"
FT   repeat_region   30654..30784
FT                   /note="TDR9 repeat: matches 76..208 of consensus"
FT   repeat_region   30716..31073
FT                   /note="Dr000396 repeat: matches 2..362 of consensus"
FT   repeat_region   complement(30701..30784)
FT                   /note="TDR9 repeat: matches 1..82 of consensus"
FT   repeat_region   30990..31104
FT                   /note="Dr000039 repeat: matches 299..415 of consensus"
FT   repeat_region   complement(30717..31077)
FT                   /note="DANA repeat: matches 1..406 of consensus"
FT   repeat_region   complement(31527..31785)
FT                   /note="drr915 repeat: matches 507..759 of consensus"
FT   repeat_region   complement(31813..32457)
FT                   /note="drr436 repeat: matches 41..686 of consensus"
FT   repeat_region   32461..32745
FT                   /note="Dr000313 repeat: matches 112..403 of consensus"
FT   repeat_region   33016..33262
FT                   /note="drr436 repeat: matches 19..264 of consensus"
FT   repeat_region   complement(33263..33794)
FT                   /note="drr915 repeat: matches 4..510 of consensus"
FT   repeat_region   33943..34120
FT                   /note="Dr000131 repeat: matches 1..178 of consensus"
FT   repeat_region   complement(33943..34120)
FT                   /note="TDR16 repeat: matches 136..313 of consensus"
FT   repeat_region   34495..34644
FT                   /note="Dr000131 repeat: matches 165..312 of consensus"
FT   repeat_region   complement(34144..34501)
FT                   /note="drr702 repeat: matches 1..363 of consensus"
FT   repeat_region   complement(34495..34645)
FT                   /note="TDR16 repeat: matches 1..149 of consensus"
FT   repeat_region   35496..35601
FT                   /note="Dr000306 repeat: matches 331..436 of consensus"
FT   repeat_region   35496..35602
FT                   /note="TDR18 repeat: matches 458..566 of consensus"
FT   repeat_region   complement(35750..36390)
FT                   /note="Dr000392 repeat: matches 557..1210 of consensus"
FT   repeat_region   complement(36394..36592)
FT                   /note="Dr000139 repeat: matches 285..500 of consensus"
FT   repeat_region   complement(36394..36853)
FT                   /note="Dr000139 repeat: matches 2..500 of consensus"
FT   repeat_region   40069..40212
FT                   /note="Dr000403 repeat: matches 1..156 of consensus"
FT   repeat_region   40212..40433
FT                   /note="Dr000262 repeat: matches 1..226 of consensus"
FT   repeat_region   complement(40074..40213)
FT                   /note="DANA repeat: matches 229..392 of consensus"
FT   repeat_region   40451..40652
FT                   /note="Dr000403 repeat: matches 160..362 of consensus"
FT   repeat_region   40637..40857
FT                   /note="Dr000248 repeat: matches 22..245 of consensus"
FT   repeat_region   complement(40451..40658)
FT                   /note="DANA repeat: matches 2..226 of consensus"
FT   repeat_region   40732..40850
FT                   /note="TDR6 repeat: matches 127..244 of consensus"
FT   repeat_region   41056..41179
FT                   /note="Dr000320 repeat: matches 1..148 of consensus"
FT   repeat_region   complement(42376..42451)
FT                   /note="Dr000340 repeat: matches 121..196 of consensus"
FT   repeat_region   complement(42399..42461)
FT                   /note="Dr000046 repeat: matches 3908..3971 of consensus"
FT   repeat_region   complement(42875..43175)
FT                   /note="Dr000005 repeat: matches 1402..1689 of consensus"
FT   repeat_region   43423..43729
FT                   /note="DANA repeat: matches 95..406 of consensus"
FT   repeat_region   complement(43410..43726)
FT                   /note="Dr000403 repeat: matches 1..308 of consensus"
FT   repeat_region   complement(43879..43948)
FT                   /note="Dr000049 repeat: matches 782..851 of consensus"
FT   repeat_region   43990..44379
FT                   /note="TC1DR2 repeat: matches 44..467 of consensus"
FT   repeat_region   44380..44443
FT                   /note="TC1DR2 repeat: matches 516..583 of consensus"
FT   repeat_region   complement(43990..44443)
FT                   /note="drr454 repeat: matches 142..634 of consensus"
FT   repeat_region   44583..44715
FT                   /note="Dr000340 repeat: matches 74..207 of consensus"
FT   repeat_region   complement(44461..44602)
FT                   /note="Dr000340 repeat: matches 72..210 of consensus"
FT   repeat_region   complement(44603..44700)
FT                   /note="Dr000340 repeat: matches 96..193 of consensus"
FT   repeat_region   complement(45202..45297)
FT                   /note="Dr000403 repeat: matches 9..107 of consensus"
FT   repeat_region   45381..45748
FT                   /note="DANA repeat: matches 1..406 of consensus"
FT   repeat_region   complement(45385..45746)
FT                   /note="Dr000396 repeat: matches 1..362 of consensus"
FT   repeat_region   45881..46109
FT                   /note="TDR18 repeat: matches 324..567 of consensus"
FT   repeat_region   45900..46107
FT                   /note="Dr000306 repeat: matches 224..436 of consensus"
FT   repeat_region   46908..47154
FT                   /note="DANA repeat: matches 1..277 of consensus"
FT   repeat_region   complement(46912..47154)
FT                   /note="Dr000396 repeat: matches 109..362 of consensus"
FT   repeat_region   48789..48880
FT                   /note="Dr000409 repeat: matches 1..92 of consensus"
FT   repeat_region   complement(48785..48864)
FT                   /note="DANA repeat: matches 327..406 of consensus"
FT   repeat_region   complement(48960..49083)
FT                   /note="drr738 repeat: matches 1..130 of consensus"
FT   repeat_region   49195..49466
FT                   /note="Dr000403 repeat: matches 90..360 of consensus"
FT   repeat_region   49257..49470
FT                   /note="Dr000396 repeat: matches 152..361 of consensus"
FT   repeat_region   49385..49529
FT                   /note="Dr000039 repeat: matches 299..444 of consensus"
FT   repeat_region   complement(49257..49473)
FT                   /note="DANA repeat: matches 3..236 of consensus"
FT   repeat_region   50079..50210
FT                   /note="Dr000407 repeat: matches 152..295 of consensus"
FT   repeat_region   complement(50079..50210)
FT                   /note="DANA repeat: matches 94..233 of consensus"
FT   repeat_region   50577..50642
FT                   /note="DANA repeat: matches 334..402 of consensus"
FT   repeat_region   complement(50577..50642)
FT                   /note="Dr000409 repeat: matches 1..69 of consensus"
FT   repeat_region   complement(50584..50642)
FT                   /note="TDR9 repeat: matches 145..206 of consensus"
FT                   /note="Dr000403 repeat: matches 2..61 of consensus"
FT   repeat_region   50744..50876
FT                   /note="Dr000320 repeat: matches 20..141 of consensus"
FT   repeat_region   complement(50913..51009)
FT                   /note="Dr000220 repeat: matches 1..100 of consensus"
FT   repeat_region   51214..51500
FT                   /note="ANGEL repeat: matches 3..308 of consensus"
FT   repeat_region   complement(51207..51502)
FT                   /note="Dr000019 repeat: matches 577..884 of consensus"
FT   repeat_region   complement(52849..52916)
FT                   /note="Dr000005 repeat: matches 1627..1692 of consensus"
FT   repeat_region   complement(53416..53565)
FT                   /note="Dr000234 repeat: matches 992..1143 of consensus"
FT   repeat_region   complement(53563..54231)
FT                   /note="Dr000234 repeat: matches 1..682 of consensus"
FT   repeat_region   complement(54231..54328)
FT                   /note="drr560 repeat: matches 197..295 of consensus"
FT   repeat_region   complement(54328..54898)
FT                   /note="Dr000255 repeat: matches 69..645 of consensus"
FT   repeat_region   complement(54969..55049)
FT                   /note="Dr000340 repeat: matches 128..209 of consensus"
FT   repeat_region   complement(55185..55363)
FT                   /note="drr918 repeat: matches 1..196 of consensus"
FT   repeat_region   55376..55596
FT                   /note="TDR6 repeat: matches 3..247 of consensus"
FT   repeat_region   55376..55785
FT                   /note="Dr000248 repeat: matches 3..435 of consensus"
FT   repeat_region   55705..55902
FT                   /note="Dr000038 repeat: matches 374..587 of consensus"
FT   repeat_region   55908..56615
FT                   /note="drr847 repeat: matches 1..708 of consensus"
FT   repeat_region   56512..56632
FT                   /note="drr924 repeat: matches 1..138 of consensus"
FT   repeat_region   complement(56636..56712)
FT                   /note="Dr000255 repeat: matches 2..78 of consensus"
FT   repeat_region   complement(56713..56907)
FT                   /note="drr560 repeat: matches 1..198 of consensus"
FT   repeat_region   57047..57326
FT                   /note="drr1074 repeat: matches 1..274 of consensus"
FT   repeat_region   57370..57516
FT                   /note="Dr000065 repeat: matches 469..614 of consensus"
FT   repeat_region   complement(57425..57513)
FT                   /note="CR1DR1 repeat: matches 3586..3674 of consensus"
FT   repeat_region   57712..57842
FT                   /note="drr595 repeat: matches 163..303 of consensus"
FT   repeat_region   58242..59183
FT                   /note="Dr000054 repeat: matches 1..953 of consensus"
FT   repeat_region   58639..59585
FT                   /note="Dr000045 repeat: matches 6..953 of consensus"
FT   repeat_region   59714..59785
FT                   /note="Dr000173 repeat: matches 357..428 of consensus"
FT   repeat_region   complement(59780..59817)
FT                   /note="Dr000369 repeat: matches 203..240 of consensus"
FT   repeat_region   59886..60054
FT                   /note="Dr000114 repeat: matches 968..1129 of consensus"
FT   repeat_region   complement(59906..60153)
FT                   /note="Dr000114 repeat: matches 876..1130 of consensus"
FT   repeat_region   complement(60046..60178)
FT                   /note="Dr000354 repeat: matches 961..1094 of consensus"
FT   repeat_region   complement(60179..60354)
FT                   /note="Dr000114 repeat: matches 3..169 of consensus"
FT   repeat_region   60392..60752
FT                   /note="DANA repeat: matches 4..406 of consensus"
FT   repeat_region   complement(60378..60479)
FT                   /note="Dr000039 repeat: matches 299..401 of consensus"
FT   repeat_region   60686..60764
FT                   /note="TDR9 repeat: matches 1..80 of consensus"
FT   repeat_region   complement(60396..60749)
FT                   /note="Dr000403 repeat: matches 1..362 of consensus"
FT   repeat_region   62124..62484
FT                   /note="Dr000407 repeat: matches 1..360 of consensus"
FT   repeat_region   62402..62506
FT                   /note="Dr000039 repeat: matches 299..403 of consensus"
FT   repeat_region   complement(62122..62492)
FT                   /note="DANA repeat: matches 1..406 of consensus"
FT   repeat_region   62726..63029
FT                   /note="DANA repeat: matches 31..406 of consensus"
FT   repeat_region   complement(62719..63026)
FT                   /note="Dr000407 repeat: matches 2..345 of consensus"
FT   repeat_region   complement(64019..64183)
FT                   /note="drr935 repeat: matches 44..223 of consensus"
FT   repeat_region   complement(64182..64361)
FT                   /note="Dr000027 repeat: matches 260..439 of consensus"
FT   repeat_region   complement(64307..64571)
FT                   /note="Dr000027 repeat: matches 1..271 of consensus"
FT   repeat_region   complement(64572..64608)
FT                   /note="drr935 repeat: matches 6..45 of consensus"
FT   repeat_region   64674..64723
FT                   /note="drr930 repeat: matches 10..59 of consensus"
FT   repeat_region   complement(64976..65040)
FT                   /note="Dr000340 repeat: matches 142..207 of consensus"
FT   repeat_region   complement(65205..65273)
FT                   /note="Dr000028 repeat: matches 92..160 of consensus"
FT   repeat_region   complement(65274..65432)
FT                   /note="Dr000350 repeat: matches 1..159 of consensus"
FT   repeat_region   65508..65641
FT                   /note="drr454 repeat: matches 219..351 of consensus"
FT   repeat_region   complement(65488..65627)
FT                   /note="Dr000400 repeat: matches 1077..1216 of consensus"
FT                   /note="TZF repeat: matches 1097..1236 of consensus"
FT   repeat_region   complement(65508..65641)
FT                   /note="TC1DR2 repeat: matches 347..479 of consensus"
FT   repeat_region   66899..67107
FT                   /note="TDR16 repeat: matches 27..239 of consensus"
FT   repeat_region   complement(66899..67107)
FT                   /note="Dr000131 repeat: matches 75..287 of consensus"
FT   repeat_region   complement(67175..67503)
FT                   /note="drr593 repeat: matches 111..442 of consensus"
FT   repeat_region   complement(67526..67743)
FT                   /note="drr706 repeat: matches 20..219 of consensus"
FT   repeat_region   complement(67876..67940)
FT                   /note="drr592 repeat: matches 25..91 of consensus"
FT   repeat_region   67945..68080
FT                   /note="Dr000220 repeat: matches 109..239 of consensus"
FT   repeat_region   68383..68477
FT                   /note="Dr000340 repeat: matches 73..166 of consensus"
FT   repeat_region   68648..68749
FT                   /note="Dr000402 repeat: matches 335..434 of consensus"
FT   repeat_region   68678..68749
FT                   /note="BRSATI repeat: matches 6..77 of consensus"
FT   repeat_region   68778..68888
FT                   /note="Dr000007 repeat: matches 655..780 of consensus"
FT   repeat_region   68894..69115
FT                   /note="Dr000338 repeat: matches 95..283 of consensus"
FT   repeat_region   68967..69194
FT                   /note="Dr000135 repeat: matches 1..191 of consensus"
FT   repeat_region   69234..69326
FT                   /note="Dr000135 repeat: matches 480..565 of consensus"
FT   repeat_region   69361..69575
FT                   /note="Dr000338 repeat: matches 453..669 of consensus"
FT   repeat_region   69574..69689
FT                   /note="Dr000007 repeat: matches 778..893 of consensus"
FT   repeat_region   69680..69756
FT                   /note="TDR13 repeat: matches 1..77 of consensus"
FT   repeat_region   69688..69875
FT                   /note="Dr000334 repeat: matches 7..192 of consensus"
FT   repeat_region   complement(69680..69801)
FT                   /note="Dr000128 repeat: matches 513..647 of consensus"
FT   repeat_region   complement(69898..70360)
FT                   /note="TDR13 repeat: matches 1..462 of consensus"
FT   repeat_region   complement(69839..70361)
FT                   /note="Dr000128 repeat: matches 1..527 of consensus"
FT   repeat_region   complement(70361..70598)
FT                   /note="Dr000143 repeat: matches 1..251 of consensus"
FT   repeat_region   72395..72671
FT                   /note="Dr000019 repeat: matches 611..878 of consensus"
FT   repeat_region   complement(72385..72473)
FT                   /note="Dr000197 repeat: matches 1..85 of consensus"
FT   repeat_region   complement(72385..72670)
FT                   /note="ANGEL repeat: matches 3..283 of consensus"
FT   repeat_region   complement(72990..73035)
FT                   /note="ANGEL repeat: matches 260..305 of consensus"
FT   repeat_region   73356..73625
FT                   /note="Dr000215 repeat: matches 351..640 of consensus"
FT   repeat_region   73356..73668
FT                   /note="Dr000108 repeat: matches 341..668 of consensus"
FT   repeat_region   73760..73973
FT                   /note="DANA repeat: matches 1..231 of consensus"
FT   repeat_region   73968..74091
FT                   /note="DANA repeat: matches 265..406 of consensus"
FT   repeat_region   complement(73765..74089)
FT                   /note="Dr000407 repeat: matches 1..363 of consensus"
FT   repeat_region   74293..74469
FT                   /note="Dr000403 repeat: matches 1..179 of consensus"
FT   repeat_region   complement(74279..74357)
FT                   /note="TDR9 repeat: matches 1..79 of consensus"
FT   repeat_region   complement(74290..74468)
FT                   /note="DANA repeat: matches 208..406 of consensus"
FT   repeat_region   complement(74611..74708)
FT                   /note="drr945 repeat: matches 1..95 of consensus"
FT   repeat_region   complement(74709..74875)
FT                   /note="drr455 repeat: matches 1..169 of consensus"
FT   repeat_region   74998..75041
FT                   /note="DANA repeat: matches 1..44 of consensus"
FT   repeat_region   complement(74998..75041)
FT                   /note="Dr000377 repeat: matches 233..276 of consensus"
FT   repeat_region   75043..75224
FT                   /note="Dr000232 repeat: matches 1..182 of consensus"
FT   repeat_region   75220..75472
FT                   /note="Dr000232 repeat: matches 293..560 of consensus"
FT   repeat_region   75504..75733
FT                   /note="DANA repeat: matches 163..405 of consensus"
FT   repeat_region   complement(75496..75731)
FT                   /note="Dr000403 repeat: matches 1..231 of consensus"
FT   repeat_region   75884..75971
FT                   /note="Dr000403 repeat: matches 1..95 of consensus"
FT   repeat_region   complement(75884..75953)
FT                   /note="DANA repeat: matches 332..403 of consensus"
FT   repeat_region   76127..76255
FT                   /note="Dr000317 repeat: matches 1046..1186 of consensus"
FT   repeat_region   76296..76410
FT                   /note="Dr000317 repeat: matches 1064..1189 of consensus"
FT   repeat_region   77773..77877
FT                   /note="TDR9 repeat: matches 110..208 of consensus"
FT   repeat_region   77813..78161
FT                   /note="Dr000407 repeat: matches 2..360 of consensus"
FT   repeat_region   78086..78180
FT                   /note="Dr000039 repeat: matches 299..402 of consensus"
FT   repeat_region   complement(77810..78168)
FT                   /note="DANA repeat: matches 2..406 of consensus"
FT   repeat_region   78518..78620
FT                   /note="Dr000397 repeat: matches 1..103 of consensus"
FT   repeat_region   78610..78646
FT                   /note="Dr000397 repeat: matches 184..220 of consensus"
FT   repeat_region   78753..79086
FT                   /note="DANA repeat: matches 31..406 of consensus"
FT   repeat_region   complement(78753..79083)
FT                   /note="Dr000403 repeat: matches 1..339 of consensus"
FT   repeat_region   79265..80163
FT                   /note="drr848 repeat: matches 1..899 of consensus"
FT   repeat_region   80168..80366
FT                   /note="DANA repeat: matches 94..292 of consensus"
FT   repeat_region   80378..80452
FT                   /note="TDR9 repeat: matches 2..76 of consensus"
FT   repeat_region   complement(80160..80442)
FT                   /note="Dr000396 repeat: matches 1..305 of consensus"
FT   repeat_region   80443..80882
FT                   /note="drr849 repeat: matches 1..440 of consensus"
FT   repeat_region   complement(80883..80995)
FT                   /note="Dr000097 repeat: matches 37..147 of consensus"
FT   repeat_region   81027..81355
FT                   /note="Dr000097 repeat: matches 267..598 of consensus"
FT   repeat_region   81336..81426
FT                   /note="Dr000097 repeat: matches 654..746 of consensus"
FT   repeat_region   81427..82258
FT                   /note="drr850 repeat: matches 1..832 of consensus"
FT   repeat_region   complement(82272..82375)
FT                   /note="Dr000340 repeat: matches 108..211 of consensus"
FT   repeat_region   82382..83284
FT                   /note="drr851 repeat: matches 1..903 of consensus"
FT   repeat_region   83286..84168
FT                   /note="Dr000033 repeat: matches 2..965 of consensus"
FT   repeat_region   84171..84621
FT                   /note="drr852 repeat: matches 1..451 of consensus"
FT   repeat_region   85313..85586
FT                   /note="CR1DR2 repeat: matches 1903..2176 of consensus"
FT   repeat_region   85584..85960
FT                   /note="CR1DR2 repeat: matches 2287..2663 of consensus"
FT   repeat_region   complement(85313..85586)
FT                   /note="Dr000079 repeat: matches 24..297 of consensus"
FT   repeat_region   complement(85584..85971)
FT                   /note="Dr000391 repeat: matches 1030..1421 of consensus"
FT   repeat_region   85972..86112
FT                   /note="Dr000391 repeat: matches 637..788 of consensus"
FT   repeat_region   86152..86255
FT                   /note="TDR18 repeat: matches 124..230 of consensus"
FT   repeat_region   complement(86152..86255)
FT                   /note="Dr000393 repeat: matches 322..428 of consensus"
FT   repeat_region   86296..86768
FT                   /note="Dr000385 repeat: matches 409..875 of consensus"
FT   repeat_region   complement(86275..86476)
FT                   /note="Dr000216 repeat: matches 297..523 of consensus"
FT   repeat_region   complement(86296..86768)
FT                   /note="TDR8 repeat: matches 615..1122 of consensus"
FT   repeat_region   86772..87071
FT                   /note="Dr000385 repeat: matches 938..1227 of consensus"
FT   repeat_region   complement(86772..87071)
FT                   /note="TDR8 repeat: matches 230..552 of consensus"
FT   repeat_region   87689..87867
FT                   /note="Dr000212 repeat: matches 88..278 of consensus"
FT   repeat_region   complement(87930..88074)
FT                   /note="drr1007 repeat: matches 623..774 of consensus"
FT   repeat_region   88639..88807
FT                   /note="Dr000403 repeat: matches 3..165 of consensus"
FT   repeat_region   complement(88656..88779)
FT                   /note="DANA repeat: matches 244..387 of consensus"
FT   repeat_region   89292..89416
FT                   /note="ANGEL repeat: matches 153..269 of consensus"
FT   repeat_region   complement(89242..89294)
FT                   /note="Dr000340 repeat: matches 143..195 of consensus"
FT   repeat_region   complement(89331..89421)
FT                   /note="Dr000019 repeat: matches 610..693 of consensus"
FT   repeat_region   89588..89870
FT                   /note="drr528 repeat: matches 1..277 of consensus"
FT   repeat_region   89925..89968
FT                   /note="Dr000197 repeat: matches 63..108 of consensus"
FT   repeat_region   89929..89970
FT                   /note="ANGEL repeat: matches 267..308 of consensus"
FT   repeat_region   complement(90903..90954)
FT                   /note="Dr000222 repeat: matches 157..208 of consensus"
FT   repeat_region   complement(90994..91126)
FT                   /note="drr529 repeat: matches 1..143 of consensus"
FT   repeat_region   91144..91759
FT                   /note="drr877 repeat: matches 1..623 of consensus"
FT   repeat_region   complement(91776..92135)
FT                   /note="drr528 repeat: matches 1..348 of consensus"
FT   repeat_region   92171..92216
FT                   /note="Dr000207 repeat: matches 2..47 of consensus"
FT   repeat_region   complement(92227..92351)
FT                   /note="drr527 repeat: matches 2..126 of consensus"
FT   repeat_region   complement(92435..93182)
FT                   /note="Dr000025 repeat: matches 2..773 of consensus"
FT   repeat_region   93285..93494
FT                   /note="Dr000286 repeat: matches 15..260 of consensus"
FT   repeat_region   complement(93177..93303)
FT                   /note="Dr000222 repeat: matches 26..151 of consensus"
FT   repeat_region   complement(93497..93621)
FT                   /note="Dr000126 repeat: matches 307..437 of consensus"
FT   repeat_region   complement(93702..93988)
FT                   /note="Dr000354 repeat: matches 3..298 of consensus"
FT   repeat_region   complement(96775..96932)
FT                   /note="Dr000329 repeat: matches 778..944 of consensus"
FT   repeat_region   97117..97165
FT                   /note="TDR14 repeat: matches 168..216 of consensus"
FT   repeat_region   complement(97091..97463)
FT                   /note="Dr000329 repeat: matches 374..766 of consensus"
FT   repeat_region   97502..97680
FT                   /note="drr489 repeat: matches 34..208 of consensus"
FT   repeat_region   complement(97500..97631)
FT                   /note="GypsyDR2_I repeat: matches 12..140 of consensus"
FT   repeat_region   97658..97966
FT                   /note="drr489 repeat: matches 294..610 of consensus"
FT   repeat_region   complement(97967..98004)
FT                   /note="drr553 repeat: matches 95..132 of consensus"
FT   repeat_region   98020..98178
FT                   /note="drr522 repeat: matches 276..431 of consensus"
FT   repeat_region   98179..98530
FT                   /note="Dr000396 repeat: matches 12..362 of consensus"
FT   repeat_region   complement(98179..98534)
FT                   /note="DANA repeat: matches 1..393 of consensus"
FT   repeat_region   99041..99272
FT                   /note="ANGEL repeat: matches 12..238 of consensus"
FT   repeat_region   complement(99041..99288)
FT                   /note="Dr000019 repeat: matches 633..868 of consensus"
FT   repeat_region   100147..100194
FT                   /note="Dr000257 repeat: matches 1..46 of consensus"
FT   repeat_region   100309..100419
FT                   /note="LINE_DR repeat: matches 534..646 of consensus"
FT   repeat_region   100309..100569
FT                   /note="Dr000391 repeat: matches 511..788 of consensus"
FT   repeat_region   complement(101347..101478)
FT                   /note="Dr000011 repeat: matches 892..1027 of consensus"
FT   repeat_region   complement(101454..102264)
FT                   /note="Dr000011 repeat: matches 1..820 of consensus"
FT   repeat_region   104322..104444
FT                   /note="Dr000145 repeat: matches 1..125 of consensus"
FT   repeat_region   104454..104497
FT                   /note="Dr000145 repeat: matches 454..496 of consensus"
FT   repeat_region   105691..105721
FT                   /note="Dr000392 repeat: matches 1..31 of consensus"
FT   repeat_region   complement(105697..106715)
FT                   /note="Dr000392 repeat: matches 165..1210 of consensus"
XX
SQ   Sequence 106778 BP; 32702 A; 18663 C; 19152 G; 36261 T; 0 other;
     aagctttttg atttacaaac caccttaata gagcactgta aaaaatgcaa gccaagctca        60
     ttctgaaaat gtacccctgt atacattttt ggagagcacc aaatatgtgc caggaggtaa       120
     gtgtttttgt tttcaagagt tcacacttag ctgatgattg gtaatgagct agtttggcat       180
     gctgtcccgg gagagagccc tgagctcata agatcctcga ggccggggct ccactctcgc       240
     catgcaaacg ggagggagta aaatgcagtt tctctgtttg tctgcattag gggtgcccaa       300
     accaagtcct ggagggctgg tgtcatactt gggctgtgtc caaaaccatc tactactcag       360
     tgagtactgc atttgaattt aaacgtacta ctcagccatt agaaaagtat gttatataca       420
     gtatgaatgt gagtagaatg aattgaattt ttgtttttgt tttcaagagt tcacacttag       480
     ctgatgattg ataatgagct agtttggcat gctgtcccgg gagagagccc tgagctcata       540
//