LOCUS       TVI309730                236 bp    DNA     linear   VRL 27-AUG-2002
DEFINITION  TT virus ORF1, clone D-95nt.
ACCESSION   AJ309730
VERSION     AJ309730.1  GI:12964229
KEYWORDS    hypothetical protein; ORF1.
SOURCE      TT virus.
  ORGANISM  TT virus
            Viruses; ssDNA viruses; unclassified ssDNA viruses.
REFERENCE   1
  AUTHORS   Grabarczyk,P. and Brojer,E.
  TITLE     Polymorphism of the TT virus and its frequency in Polish blood
            donors
  JOURNAL   Vox Sang. 82 (4), 177-181 (2002)
  MEDLINE   22043976
REFERENCE   2  (bases 1 to 236)
  AUTHORS   Grabarczyk,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2001) Grabarczyk P., Department of Hematolgy and
            Transfusion Immunology, Institute of Hematology and Blood
            Transfusion, Chocimska 5, Warsaw, 00-957, POLAND
FEATURES             Location/Qualifiers
     source          1..236
                     /organism="TT virus"
                     /virion
                     /specific_host="homo sapiens"
                     /db_xref="taxon:68887"
                     /clone="D-95nt"
                     /country="Poland"
     CDS             <1..>236
                     /note="ORF1"
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="CAC29352.1"
                     /db_xref="GI:12964230"
                     /db_xref="SPTREMBL:Q998P8"
                     /translation="NMLWIDWLSKNNMEYAKVQSKCLVADLPLWAAAYGYLEFCSKST
                     GDTNIHMNARCVIRSPFTDPQLIVHTNPNKGFVP"
BASE COUNT       86 a     51 c     47 g     52 t
ORIGIN      
        1 gcaacatgtt atggatagac tggcttagta aaaataacat ggaatatgcc aaagtgcaaa
       61 gcaagtgcct agtagcagac ctaccactgt gggcagcagc atatgggtat ttagaattct
      121 gctctaaaag cacaggagac acaaacatac acatgaatgc cagatgtgta ataagaagtc
      181 cctttacaga cccccagtta atagtacaca caaaccccaa taaaggcttt gtacct
//